Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00480 192 / 2e-60 ATCG00480.1, ATPB ATP synthase subunit beta (.1) AT5G08690 157 / 6e-47 ATP synthase alpha/beta family protein (.1) AT5G08670 157 / 6e-47 ATP synthase alpha/beta family protein (.1) AT5G08680 157 / 6e-47 ATP synthase alpha/beta family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G162800 [exp] 196 / 7e-62 ATCG00480 927 / 0.0 ATP synthase subunit beta (.1) Potri.010G116600 [exp] 157 / 7e-47 AT5G08690 871 / 0.0 ATP synthase alpha/beta family protein (.1) Potri.008G126600 [exp] 156 / 3e-46 AT5G08690 892 / 0.0 ATP synthase alpha/beta family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032827 [exp] 192 / 2e-62 ATCG00480 557 / 0.0 ATP synthase subunit beta (.1) Lus10009173 [exp] 191 / 4e-60 ATCG00480 890 / 0.0 ATP synthase subunit beta (.1) Lus10035263 [exp] 155 / 3e-46 AT5G08680 782 / 0.0 ATP synthase alpha/beta family protein (.1) Lus10034631 [exp] 155 / 5e-46 AT5G08680 928 / 0.0 ATP synthase alpha/beta family protein (.1) Lus10035264 [exp] 155 / 5e-46 AT5G08680 925 / 0.0 ATP synthase alpha/beta family protein (.1) Lus10034632 [exp] 121 / 2e-33 AT5G08680 875 / 0.0 ATP synthase alpha/beta family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00006 [poplar] [flax] ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain
Representative CDS sequence Show only first row Show all	>Potri.007G062122.1 pacid=42766715 polypeptide=Potri.007G062122.1.p locus=Potri.007G062122 ID=Potri.007G062122.1.v4.1 annot-version=v4.1 ATGGGTTCTTTACAAGAAAGAATTACTTCTACCAGGTCCATAACTTCTATTCAAGCAGTTTATGTACCTGCGGACGATTTAACCGACCCTGCTCCTGCCA CGACATTTGCGCATTTAGATGCTACTACTGTACTATCAAGAGGATTAGCTGCTAAAGGTATCTATCCAGCAGTCGACCCTTTAGATTCAACATCAACTAT GCTCCAACCTCAGATCGTTGGCGAGGAACATTATGAAACTGCGCAAAGAGTTAAGCAAACTTTACAACGTTACAAAGAACTTCAAGACATTATAGCTATC CGGACGAATTATCCGAAGAGGATCGCTTAA
AA sequence Show only first row Show all	>Potri.007G062122.1 pacid=42766715 polypeptide=Potri.007G062122.1.p locus=Potri.007G062122 ID=Potri.007G062122.1.v4.1 annot-version=v4.1 MGSLQERITSTRSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAI RTNYPKRIA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Potri.007G062122 [exp]	0	1
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Potri.013G162800 [exp]	3.16	0.9782
ATCG00560		ATCG00560.1, PS...	photosystem II reaction center...		Potri.013G162100 [exp]	3.16	0.9594
ATCG00520		ATCG00520.1, YC...	unfolded protein binding (.1)		Potri.016G094067 [exp]	3.87	0.9681
					Potri.007G062061 [exp]	4.00	0.9577
ATCG00530		ATCG00530.1, YC...	CemA-like proton extrusion pro...		Potri.016G094100 [exp]	6.92	0.9590
ATCG00905		ATCG00905.1, RP...	ribosomal protein S12C (.1)		Potri.001G305350 [exp]	7.41	0.9547
ATCG00360		ATCG00360.1, YC...	Tetratricopeptide repeat (TPR)...		Potri.013G141700 [exp]	9.38	0.9597
ATCG01250		ATCG01250.1, ND...	NADH-Ubiquinone/plastoquinone ...		Potri.011G075051 [exp]	10.19	0.9526
ATCG00520		ATCG00520.1, YC...	unfolded protein binding (.1)		Potri.013G162400 [exp]	11.22	0.9524
ATCG00500		ATCG00500.1, AC...	acetyl-CoA carboxylase carboxy...		Potri.013G162600 [exp]	15.16	0.9406

Compare expression of checked genes

Potri.007G062122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.