Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00470 219 / 5e-75 ATCG00470.1, ATPE ATP synthase epsilon chain (.1) AT5G47030 47 / 5e-07 ATPase, F1 complex, delta/epsilon subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G053000 [exp] 41 / 7e-05 AT5G47030 308 / 6e-108 ATPase, F1 complex, delta/epsilon subunit (.1) Potri.003G086100 [exp] 39 / 0.0002 AT5G47030 291 / 2e-101 ATPase, F1 complex, delta/epsilon subunit (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011038 [exp] 42 / 8e-05 AT5G47040 1413 / 0.0 lon protease 2 (.1) Lus10040130 [exp] 41 / 8e-05 AT5G47030 316 / 3e-111 ATPase, F1 complex, delta/epsilon subunit (.1) Lus10001082 [exp] 41 / 0.0001 AT5G47030 315 / 6e-111 ATPase, F1 complex, delta/epsilon subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00401 [poplar] [flax] ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain PF02823 [poplar] [flax] ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Representative CDS sequence Show only first row Show all	>Potri.007G062142.1 pacid=42766397 polypeptide=Potri.007G062142.1.p locus=Potri.007G062142 ID=Potri.007G062142.1.v4.1 annot-version=v4.1 ATGATCTTAAGTCTTTGTGTATTGACCCCGAATCGAATTGTTTGGGATTCAGAAGTGAAAGAAATCATTTTATCTACTAATAGTGGGCAAATTGGTGTAT TACCTAATCACGCGCCTATTGCCACAGCCGTTGATATCGGTATTTTGAGAATACGCCTTAATGACCAATGGTTAACGATGGCTCTGATGGGCGGTTTTGC TAGAATAGGCAATAATGAGGTTACTGTTTTAGTAAATGATGCGGAGAAGGGGAGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCAGAA GCTAACTTGAGGAAAGCGGAAGGCAAGAGACAAATAATCGAGGCAAATCTAGCTCTCAGACGAGCTAGAGCACGAGTAGAGGCTATCAATGTGATTTCGT AA
AA sequence Show only first row Show all	>Potri.007G062142.1 pacid=42766397 polypeptide=Potri.007G062142.1.p locus=Potri.007G062142 ID=Potri.007G062142.1.v4.1 annot-version=v4.1 MILSLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILRIRLNDQWLTMALMGGFARIGNNEVTVLVNDAEKGSDIDPQEAQQTLEIAE ANLRKAEGKRQIIEANLALRRARARVEAINVIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATCG00470		ATCG00470.1, AT...	ATP synthase epsilon chain (.1...		Potri.007G062142 [exp]	0	1
ATCG00580		ATCG00580.1, PS...	photosystem II reaction center...		Potri.013G161900 [exp]	8.83	0.8590
ATCG00510		ATCG00510.1, PS...	photsystem I subunit I (.1)		Potri.013G162500 [exp]	12.96	0.8521
ATCG00520		ATCG00520.1, YC...	unfolded protein binding (.1)		Potri.013G162400 [exp]	17.88	0.8518
ATCG00530		ATCG00530.1, YC...	CemA-like proton extrusion pro...		Potri.013G162300 [exp]	20.66	0.8451
ATCG00520		ATCG00520.1, YC...	unfolded protein binding (.1)		Potri.016G094067 [exp]	22.02	0.8462
ATCG00270		ATCG00270.1, PS...	photosystem II reaction center...		Potri.008G207200 [exp]	23.45	0.8414
ATCG00570		ATCG00570.1, PS...	photosystem II reaction center...		Potri.013G162000 [exp]	23.62	0.8434
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Potri.013G162800 [exp]	24.49	0.8459
ATCG00530		ATCG00530.1, YC...	CemA-like proton extrusion pro...		Potri.016G094100 [exp]	33.22	0.8318
ATCG00560		ATCG00560.1, PS...	photosystem II reaction center...		Potri.013G162100 [exp]	33.33	0.8345

Compare expression of checked genes

Potri.007G062142 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.