Potri.007G062482 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATMG01320 105 / 9e-30 NAD2.2, ATMG01320.1, NAD2B NADH DEHYDROGENASE 2.2, NADH dehydrogenase 2B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G062482.1 pacid=42765686 polypeptide=Potri.007G062482.1.p locus=Potri.007G062482 ID=Potri.007G062482.1.v4.1 annot-version=v4.1
ATGTTTTTTGATACACCTAGGACATGGATTCTATATGAACCAATGGATCGTAACAAGTCGTTACTACTAGCAATGACTTCTTCTTTCATTACTTCATCCT
TTCTATATCCCTCTCCCTTGTTCTCAGTTACTCATCAAATGGCACTCAGTTCATATCTTTAA
AA sequence
>Potri.007G062482.1 pacid=42765686 polypeptide=Potri.007G062482.1.p locus=Potri.007G062482 ID=Potri.007G062482.1.v4.1 annot-version=v4.1
MFFDTPRTWILYEPMDRNKSLLLAMTSSFITSSFLYPSPLFSVTHQMALSSYL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATMG01320 NAD2.2, ATMG013... NADH DEHYDROGENASE 2.2, NADH d... Potri.007G062482 0 1
ATMG00650 ATMG00650.1, NA... NADH dehydrogenase subunit 4L ... Potri.007G061661 2.64 0.9840
ATMG00650 ATMG00650.1, NA... NADH dehydrogenase subunit 4L ... Potri.007G062622 4.00 0.9840
ATMG00410 ATMG00410.1, AT... ATPase subunit 6-1 (.1) Potri.014G168000 4.24 0.9811
ATMG00070 ATMG00070.1, NA... NADH dehydrogenase subunit 9 (... Potri.013G066660 5.65 0.9784
AT2G07751 NADH:ubiquinone/plastoquinone ... Potri.007G062001 9.38 0.9723
ATMG00480 ATP8, ATMG00480... ATP SYNTHASE 8, Plant mitochon... Potri.016G011500 11.22 0.9676
ATMG00580 ATMG00580.1, NA... NADH dehydrogenase subunit 4 (... Potri.007G061881 11.83 0.9714
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G061641 12.00 0.9737
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G062602 12.68 0.9731
AT2G07689 NADH-Ubiquinone/plastoquinone ... Potri.007G062522 13.26 0.9712

Potri.007G062482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.