Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATMG00650 125 / 4e-39 ATMG00650.1, NAD4L NADH dehydrogenase subunit 4L (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G061661 [exp] 140 / 4e-45 ATMG00650 125 / 4e-39 NADH dehydrogenase subunit 4L (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004838 [exp] 69 / 1e-16 ATMG00650 71 / 1e-17 NADH dehydrogenase subunit 4L (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00420 [poplar] [flax] Oxidored_q2 NADH-ubiquinone/plastoquinone oxidoreductase chain 4L
Representative CDS sequence Show only first row Show all	>Potri.007G062622.1 pacid=42766216 polypeptide=Potri.007G062622.1.p locus=Potri.007G062622 ID=Potri.007G062622.1.v4.1 annot-version=v4.1 ATGGATCCTCTTAAATATTTCACATTTTCTATGATCATCTTTATTTTAGGTATTTGGGGAATCCTCCTTAATAGACGAAATATTCCTATTATGTTAATGC CAATTGAATTAATGTTATTAGCTGTGAATTTGAACTTTTTGGTCTTTTCTGTTTCTTTGGATGATATGATGGGTCAATTATTTGCTTTATTGGTTCCAAC GGTGGCAGCTGCGGAATCCGCTATTGGGTTAGCCATTTTCGTTATTACTTTCCGAGTCCGAGGGACTATTGCTGTAGAATTTATTAATAGCATTCAAGGT TAA
AA sequence Show only first row Show all	>Potri.007G062622.1 pacid=42766216 polypeptide=Potri.007G062622.1.p locus=Potri.007G062622 ID=Potri.007G062622.1.v4.1 annot-version=v4.1 MDPLKYFTFSMIIFILGIWGILLNRRNIPIMLMPIELMLLAVNLNFLVFSVSLDDMMGQLFALLVPTVAAAESAIGLAIFVITFRVRGTIAVEFINSIQG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
ATMG00650		ATMG00650.1, NA...	NADH dehydrogenase subunit 4L ...		Potri.007G062622 [exp]	0	1
ATMG00650		ATMG00650.1, NA...	NADH dehydrogenase subunit 4L ...		Potri.007G061661 [exp]	1.00	0.9987
ATMG00410		ATMG00410.1, AT...	ATPase subunit 6-1 (.1)		Potri.014G168000 [exp]	1.41	0.9913
ATMG00580		ATMG00580.1, NA...	NADH dehydrogenase subunit 4 (...		Potri.007G061881 [exp]	3.74	0.9852
ATMG00640		ATMG00640.1, OR...	hydrogen ion transporting ATP ...		Potri.007G062602 [exp]	3.87	0.9875
ATMG01320		NAD2.2, ATMG013...	NADH DEHYDROGENASE 2.2, NADH d...		Potri.007G062482 [exp]	4.00	0.9840
ATMG00640		ATMG00640.1, OR...	hydrogen ion transporting ATP ...		Potri.007G061641 [exp]	4.89	0.9866
AT2G07751			NADH:ubiquinone/plastoquinone ...		Potri.007G062001 [exp]	7.07	0.9816
ATMG00070		ATMG00070.1, NA...	NADH dehydrogenase subunit 9 (...		Potri.013G066660 [exp]	8.94	0.9794
AT2G07689			NADH-Ubiquinone/plastoquinone ...		Potri.007G062522 [exp]	9.38	0.9810
					Potri.008G224147 [exp]	9.79	0.9864

Compare expression of checked genes

Potri.007G062622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.