Potri.007G064401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20823 119 / 8e-34 RING/U-box superfamily protein (.1)
AT1G76410 115 / 2e-32 ATL8 RING/U-box superfamily protein (.1)
AT2G17450 113 / 8e-32 RHA3A RING-H2 finger A3A (.1)
AT4G35480 109 / 6e-30 RHA3B RING-H2 finger A3B (.1)
AT5G05280 96 / 4e-25 RING/U-box superfamily protein (.1)
AT5G01880 85 / 4e-21 RING/U-box superfamily protein (.1)
AT3G10910 82 / 1e-19 RING/U-box superfamily protein (.1)
AT4G17905 83 / 5e-19 ATL4H RING/U-box superfamily protein (.1)
AT3G18773 81 / 7e-19 RING/U-box superfamily protein (.1)
AT1G49220 79 / 4e-18 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G099000 166 / 4e-52 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.002G006400 114 / 4e-32 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1)
Potri.005G255200 113 / 1e-31 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1)
Potri.013G091300 89 / 4e-22 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.019G057700 89 / 5e-22 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.016G136200 86 / 3e-21 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.001G309600 87 / 5e-21 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.001G309700 85 / 3e-20 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.003G075200 83 / 3e-20 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030728 122 / 5e-35 AT1G20823 209 / 6e-69 RING/U-box superfamily protein (.1)
Lus10013210 117 / 4e-33 AT1G20823 207 / 3e-68 RING/U-box superfamily protein (.1)
Lus10025162 110 / 1e-30 AT1G20823 190 / 6e-62 RING/U-box superfamily protein (.1)
Lus10016040 110 / 2e-30 AT1G20823 202 / 4e-66 RING/U-box superfamily protein (.1)
Lus10033515 87 / 4e-21 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
Lus10029037 86 / 4e-21 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10022743 85 / 1e-20 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10025146 84 / 2e-20 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1)
Lus10006788 84 / 7e-20 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10020859 84 / 1e-19 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.007G064401.1 pacid=42765484 polypeptide=Potri.007G064401.1.p locus=Potri.007G064401 ID=Potri.007G064401.1.v4.1 annot-version=v4.1
ATGCCTCGCTTTTCAAGAATCCTCTACGCCTCCGCGGATGCGGCAGCGCCCCCAGCGGCTGTTAGCGTTCAGTCTGACCTTATGGTTATATTAGCAGCTC
TTCTGTGTGCATTACTATGCGTGGTGGGGCTTATTTTGATGGCTCGTTGTGCCTGCACCCGCCGTGTTACTGGTGGGTCACCGTCATCGGACAAAGCTAA
CAAGGGTGTGAAGAAGAAGAACCTCCAGCTGCTGCCCAGGTTCAGTTACTCTGCTGGAGATGGTAGCGGAGAGGGTGGTGGCGCCACCACCAAGTTTGGA
TCAACAGAGTGCGCAATTTGCTTGGGTGAGTTTGTTGAAGGAGATGAAGTTAGGGTTTTGCCTCAGTGTGGACATAGCTTCCATGTTGTCTGCATTGACA
CATGGCTTAGGTCTCATTCCTCTTGTCCCTCTTGCCGTCAGATTTTGGTGGTGGCTAGGTGTCAGAAATGTAGTCATTTTCCTGCTTCCACCTCCTCCGC
CTCCTGTGGTGGTGGACCTGCCACTGGAGAAGATTGCAATGTCAAAAACAGTGATACCAATCATGCCCAAGAAATGTAG
AA sequence
>Potri.007G064401.1 pacid=42765484 polypeptide=Potri.007G064401.1.p locus=Potri.007G064401 ID=Potri.007G064401.1.v4.1 annot-version=v4.1
MPRFSRILYASADAAAPPAAVSVQSDLMVILAALLCALLCVVGLILMARCACTRRVTGGSPSSDKANKGVKKKNLQLLPRFSYSAGDGSGEGGGATTKFG
STECAICLGEFVEGDEVRVLPQCGHSFHVVCIDTWLRSHSSCPSCRQILVVARCQKCSHFPASTSSASCGGGPATGEDCNVKNSDTNHAQEM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G20823 RING/U-box superfamily protein... Potri.007G064401 0 1
AT4G38020 tRNA/rRNA methyltransferase (S... Potri.005G147600 5.74 0.7720
AT2G02570 nucleic acid binding;RNA bindi... Potri.004G229200 7.74 0.7549
AT4G13720 Inosine triphosphate pyrophosp... Potri.003G175800 8.48 0.7375
AT3G02600 ATLPP3, LPP3 lipid phosphate phosphatase 3 ... Potri.017G119500 10.39 0.6899
AT4G16160 ATOEP16-2, ATOE... Mitochondrial import inner mem... Potri.008G107200 13.11 0.6764
AT5G40500 unknown protein Potri.001G344700 13.78 0.6819
AT5G06210 RNA binding (RRM/RBD/RNP motif... Potri.006G208500 14.69 0.6990
AT3G53140 O-methyltransferase family pro... Potri.006G120000 18.02 0.7085 COMTL4
AT3G49645 unknown protein Potri.017G091300 24.49 0.6585
AT5G40100 Disease resistance protein (TI... Potri.006G283100 26.92 0.6889

Potri.007G064401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.