Potri.007G068000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G096000 130 / 2e-41 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G068000.1 pacid=42765911 polypeptide=Potri.007G068000.1.p locus=Potri.007G068000 ID=Potri.007G068000.1.v4.1 annot-version=v4.1
ATGTATTATCTAACTTTGGTAGCTTATTACATATATTTCAATTCATCCAAGGTCTTTTATTATCTTTCTCTACTTATCATGGCTTTGTTTTACATGTTTG
TATTCAAGGAAAGTGTGAGAGATACACAAAAATTAGCAGCTTGGGTTTGTAAGCAAGAGGCCAGGGATTTGTTTTGTTTGCAATTTGAAGAGAGTGCTAC
TACTTCAGCTGCGCATCTTCATGATTCAAATGCGTCCTATTATAGCTAG
AA sequence
>Potri.007G068000.1 pacid=42765911 polypeptide=Potri.007G068000.1.p locus=Potri.007G068000 ID=Potri.007G068000.1.v4.1 annot-version=v4.1
MYYLTLVAYYIYFNSSKVFYYLSLLIMALFYMFVFKESVRDTQKLAAWVCKQEARDLFCLQFEESATTSAAHLHDSNASYYS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G068000 0 1
AT1G65450 HXXXD-type acyl-transferase fa... Potri.010G180000 1.41 0.9948
AT5G57800 CER3, FLP1, YRE... FACELESS POLLEN 1, ECERIFERUM ... Potri.018G099400 2.82 0.9916
AT2G38110 ATGPAT6, GPAT6 glycerol-3-phosphate acyltrans... Potri.016G113100 6.48 0.9928
AT2G18360 alpha/beta-Hydrolases superfam... Potri.009G116800 7.74 0.9886
AT1G56580 SVB SMALLER WITH VARIABLE BRANCHES... Potri.013G007000 9.00 0.9919
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Potri.010G079300 10.39 0.9886
AT3G26040 HXXXD-type acyl-transferase fa... Potri.019G001200 12.44 0.9893
AT5G33370 GDSL-like Lipase/Acylhydrolase... Potri.019G024800 15.09 0.9890
AT2G16630 Pollen Ole e 1 allergen and ex... Potri.004G169200 16.61 0.9655
AT5G04660 CYP77A4 "cytochrome P450, family 77, s... Potri.008G025500 16.73 0.9888

Potri.007G068000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.