Plant FIBer expression Database

Potri.007G071350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATMG00510 74 / 2e-17 ATMG00510.1, NAD7 NADH dehydrogenase subunit 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000459
[exp]
75 / 1e-18 ATMG00510 306 / 1e-104 NADH dehydrogenase subunit 7 (.1)
Lus10009720
[exp]
74 / 1e-18 ATMG00510 309 / 2e-106 NADH dehydrogenase subunit 7 (.1)
PFAM info
Representative CDS sequence
>Potri.007G071350.1 pacid=42765386 polypeptide=Potri.007G071350.1.p locus=Potri.007G071350 ID=Potri.007G071350.1.v4.1 annot-version=v4.1
ATGGCCCAAGAACACGCTTATTCTTCAGCCGTAGAGAAACTTTTGAATTGCGAGGTACCATTACGAGCTCAATATATACGAGTGTTATTCCATGAAATAA
CTCGAATTTGTCCATCGATATCCTATTGTCTTAGCGCAAACTTTACTTTAAAGAACACCACCACTTGTAATGAAATGTAG
AA sequence
>Potri.007G071350.1 pacid=42765386 polypeptide=Potri.007G071350.1.p locus=Potri.007G071350 ID=Potri.007G071350.1.v4.1 annot-version=v4.1
MAQEHAYSSAVEKLLNCEVPLRAQYIRVLFHEITRICPSISYCLSANFTLKNTTTCNEM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATMG00510 ATMG00510.1, NA... NADH dehydrogenase subunit 7 (... Potri.007G071350
[exp]
0 1
ATMG00160 ATMG00160.1, CO... cytochrome oxidase 2 (.1) Potri.007G061781
[exp]
1.00 0.9803
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.016G094033
[exp]
2.82 0.9619
AT2G07751 NADH:ubiquinone/plastoquinone ... Potri.007G062001
[exp]
4.47 0.9732
Potri.007G062081
[exp]
6.16 0.9509
ATMG00730 ATMG00730.1, CO... cytochrome c oxidase subunit 3... Potri.007G062402
[exp]
6.32 0.9495
ATMG00410 ATMG00410.1, AT... ATPase subunit 6-1 (.1) Potri.014G168000
[exp]
10.19 0.9726
Potri.007G061901
[exp]
10.19 0.9427
ATMG00650 ATMG00650.1, NA... NADH dehydrogenase subunit 4L ... Potri.007G062622
[exp]
14.69 0.9669
ATMG00650 ATMG00650.1, NA... NADH dehydrogenase subunit 4L ... Potri.007G061661
[exp]
16.30 0.9633
ATMG01010 ATMG01010.1, OR... Unknown conserved protein (.1) Potri.007G062262
[exp]
16.97 0.9519

Potri.007G071350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.