Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23140 383 / 1e-135 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G02560 169 / 7e-51 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G66670 151 / 1e-43 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT5G45390 150 / 1e-43 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) ATCG00670 132 / 8e-38 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G12410 131 / 2e-36 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT4G17040 127 / 8e-35 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G11750 125 / 2e-34 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT1G09130 116 / 2e-30 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 87 / 2e-19 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G092600 [exp] 442 / 4e-159 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.014G119700 [exp] 170 / 4e-51 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.002G195200 [exp] 169 / 6e-51 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.003G103300 [exp] 158 / 1e-46 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G092100 [exp] 156 / 2e-45 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.004G152900 [exp] 136 / 2e-38 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 135 / 4e-38 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.003G083300 [exp] 129 / 3e-35 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1) Potri.001G115900 [exp] 127 / 8e-35 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017397 [exp] 378 / 1e-133 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 375 / 4e-132 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 322 / 6e-111 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 320 / 5e-110 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 311 / 1e-106 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10013435 [exp] 184 / 6e-56 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10002422 [exp] 157 / 4e-46 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 157 / 1e-45 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10025022 [exp] 136 / 3e-38 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010003 [exp] 136 / 4e-38 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.007G071700.1 pacid=42765453 polypeptide=Potri.007G071700.1.p locus=Potri.007G071700 ID=Potri.007G071700.1.v4.1 annot-version=v4.1 ATGGCCCTCTCCTTCAAAATCACAGAACTCAATCCCCTAAACCCCAACAAAATCCCCAATTCCTCTCAAACCCTAAAACCCCGTTATCCCTCTCTCAATT TCTCCAAATCCAATCCCAAACCCAAATCAACAGCCATGAAAGCCCTCTTCTCCTCCGCCAAGCTCATCACTTCAACAACTAAAACAAAACCCTCTTTTCT TTTGACCCCAAAAATCTCAACCACTAGAGCTTACAGTCTAATCCCAATGGTCATCGAACACTCATCAAGAGGAGAAAGAGCTTATGATATCTTTTCTAGG CTTTTAAAAGAGAGAATTGTTTGTATTAATGGTCCAATCGATGATGATACTTCTCATGTTGTTGTTGCTCAGCTTTTGTTTCTTGAGTCTGAGAATCCTT CTAAGCCTATTCATATGTATCTGAATTCTCCTGGTGGACAGGTCACTGCAGGCCTTGCCATTTATGATACAATGCAGTACATAAGGTCTCCAGTTACTAC CATTTGTTTGGGTCAGGCTGCATCTATGGCTTCCCTCCTCTTGGCTGCCGGGGCTAAGGGCGAGAGGAAGGCACTACCAAATGCAACAATCATGATTCAT CAGCCATCAGGTGGGTACAGCGGACAGGCAAAGGACATGACAATTCACACAAAGCAGATAGTTCGGGTCTGGGATGCTCTGAATCAATTGTACTGCAAGC ATACAGGGCAGCCACTTGATGTAATTCAGAAGAATATGGATAGAGATTATTTTATGACCCCAGAAGAGGCAAAGGAATTTGGAATTATCGATGATGTGAT TGATCAAAGACCCATGACTTTGGTGACTGATGCTGTTGACGATGAAGGCAAACAAAAGGATTCAAGCTAG
AA sequence Show only first row Show all	>Potri.007G071700.1 pacid=42765453 polypeptide=Potri.007G071700.1.p locus=Potri.007G071700 ID=Potri.007G071700.1.v4.1 annot-version=v4.1 MALSFKITELNPLNPNKIPNSSQTLKPRYPSLNFSKSNPKPKSTAMKALFSSAKLITSTTKTKPSFLLTPKISTTRAYSLIPMVIEHSSRGERAYDIFSR LLKERIVCINGPIDDDTSHVVVAQLLFLESENPSKPIHMYLNSPGGQVTAGLAIYDTMQYIRSPVTTICLGQAASMASLLLAAGAKGERKALPNATIMIH QPSGGYSGQAKDMTIHTKQIVRVWDALNQLYCKHTGQPLDVIQKNMDRDYFMTPEEAKEFGIIDDVIDQRPMTLVTDAVDDEGKQKDSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Potri.007G071700 [exp]	0	1
AT1G65030			Transducin/WD40 repeat-like su...		Potri.012G107400 [exp]	1.41	0.9342
AT2G25830			YebC-related (.1)		Potri.006G238400 [exp]	3.16	0.9007
AT2G20690			lumazine-binding family protei...		Potri.013G131800 [exp]	3.46	0.8932
AT1G02140		MAGO, HAP1, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.002G138500 [exp]	3.46	0.9223
AT2G35790			unknown protein		Potri.010G219400 [exp]	3.60	0.8911
AT2G18510		EMB2444	embryo defective 2444, RNA-bin...		Potri.007G028300 [exp]	5.29	0.9079
AT5G53070			Ribosomal protein L9/RNase H1 ...		Potri.012G121228 [exp]	8.77	0.8958
AT3G06610			DNA-binding enhancer protein-r...		Potri.008G105000 [exp]	9.16	0.8743
AT5G24460			unknown protein		Potri.015G002500 [exp]	9.89	0.8987
AT5G58920			unknown protein		Potri.009G042300 [exp]	13.96	0.8636

Compare expression of checked genes

Potri.007G071700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.