Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17770 39 / 3e-05 CBR1, ATCBR NADH:cytochrome B5 reductase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G068500 [exp] 65 / 7e-16 AT5G17770 104 / 1e-28 NADH:cytochrome B5 reductase 1 (.1) Potri.013G067300 [exp] 62 / 2e-13 AT5G17770 461 / 6e-166 NADH:cytochrome B5 reductase 1 (.1) Potri.004G194400 [exp] 46 / 1e-07 AT5G17770 428 / 4e-153 NADH:cytochrome B5 reductase 1 (.1) Potri.009G157000 [exp] 45 / 3e-07 AT5G17770 421 / 3e-150 NADH:cytochrome B5 reductase 1 (.1) Potri.010G246800 [exp] 40 / 2e-05 AT5G17770 379 / 1e-133 NADH:cytochrome B5 reductase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020310 [exp] 54 / 3e-10 AT5G17770 474 / 5e-171 NADH:cytochrome B5 reductase 1 (.1) Lus10005682 [exp] 49 / 1e-08 AT5G17770 474 / 6e-171 NADH:cytochrome B5 reductase 1 (.1) Lus10034869 [exp] 40 / 2e-05 AT5G17770 280 / 3e-94 NADH:cytochrome B5 reductase 1 (.1) Lus10033405 [exp] 39 / 7e-05 AT5G17770 359 / 2e-125 NADH:cytochrome B5 reductase 1 (.1) Lus10026774 [exp] 37 / 0.0003 AT5G17770 425 / 1e-151 NADH:cytochrome B5 reductase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G072750.1 pacid=42766042 polypeptide=Potri.007G072750.1.p locus=Potri.007G072750 ID=Potri.007G072750.1.v4.1 annot-version=v4.1 ATGAATTTAGAATTCTTGCACACTCTTGATGTTCAGATTCTTGGGGCTGTAGCTGTGGCTATTGTGGCCATTGTTATTGGTGTTGTCTTTCTCTTCTCCT ATAAAAAGCCCAAAGGCTGCTTAGATCCAGAAAATTTCAAGCAGTTTAAACTTGTCAAGCGTGTTTAG
AA sequence Show only first row Show all	>Potri.007G072750.1 pacid=42766042 polypeptide=Potri.007G072750.1.p locus=Potri.007G072750 ID=Potri.007G072750.1.v4.1 annot-version=v4.1 MNLEFLHTLDVQILGAVAVAIVAIVIGVVFLFSYKKPKGCLDPENFKQFKLVKRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Potri.007G072750 [exp]	0	1
AT5G54240			Protein of unknown function (D...		Potri.001G408001 [exp]	1.00	0.9661
AT4G16340		SPK1	SPIKE1, guanyl-nucleotide exch...		Potri.004G000750 [exp]	4.89	0.9370
AT4G27080		ATPDI7, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.011G135500 [exp]	5.09	0.9485
AT5G23860		TUB8, b-TUB	tubulin beta 8 (.1.2)		Potri.016G107300 [exp]	7.07	0.9384
AT3G19090			RNA-binding protein (.1)		Potri.009G106500 [exp]	7.34	0.9131
AT2G45310		GAE4	UDP-D-glucuronate 4-epimerase ...		Potri.002G116750 [exp]	8.12	0.9141
AT2G37980			O-fucosyltransferase family pr...		Potri.006G095300 [exp]	9.79	0.9202
AT3G01750			Ankyrin repeat family protein ...		Potri.010G055700 [exp]	10.95	0.9239
AT1G05910			cell division cycle protein 48...		Potri.017G031150 [exp]	11.66	0.9116
AT1G30300			Metallo-hydrolase/oxidoreducta...		Potri.011G081600 [exp]	16.73	0.9221

Compare expression of checked genes

Potri.007G072750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.