Potri.007G072900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22300 143 / 8e-43 RPS10 ribosomal protein S10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence
>Potri.007G072900.3 pacid=42765972 polypeptide=Potri.007G072900.3.p locus=Potri.007G072900 ID=Potri.007G072900.3.v4.1 annot-version=v4.1
ATGTCAAGACAAGCAAAAAATCTTGTATCGTTTTTCTCTTCAAAGATTTCATCTTTTTCTTACTCACAATCTCGCTCTTTCACGGCGGCTCCTCCACCAC
CACCAGCAGTGTTTGTTAACAAGAATTGTCAAGGAATCACTGGAAAGAATGAAAGCGGTACTAAAATGCCTACAGTTGCATCTTCATCTGGACTTACTGC
TGGAGGACACCAAGAAGAAAGACCACCAAAAGCAATGACCACCAAGATATGCATAGCGATTCGATCTTTTGAAGATCTAGTTCCTGGAAACACTATTTCA
GGGATTCCAGCTGATGCACGGAAGATTAGATTGCCTGAATCACGTGTCTTATATACTGTGTTACGATCACCTCACGTTGATAAAAAGTCCAGGGAACAAT
TTGAAATGCGAATAAAGAAACAGATTTTGGTCATGAAAACACAAAGCCATGAATTGCGCAATAAGTATTTTTGGTTAAAACGCCAGCGAATATTTGGAGC
TCAATATGAAATTCAGTTTCATTGTAAGACCCGTTTGGATAAGGACGAACTCCAGAAACTGCTGCTTTGA
AA sequence
>Potri.007G072900.3 pacid=42765972 polypeptide=Potri.007G072900.3.p locus=Potri.007G072900 ID=Potri.007G072900.3.v4.1 annot-version=v4.1
MSRQAKNLVSFFSSKISSFSYSQSRSFTAAPPPPPAVFVNKNCQGITGKNESGTKMPTVASSSGLTAGGHQEERPPKAMTTKICIAIRSFEDLVPGNTIS
GIPADARKIRLPESRVLYTVLRSPHVDKKSREQFEMRIKKQILVMKTQSHELRNKYFWLKRQRIFGAQYEIQFHCKTRLDKDELQKLLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22300 RPS10 ribosomal protein S10 (.1) Potri.007G072900 0 1
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.002G057600 13.11 0.8854 RPL18.7
AT5G59240 Ribosomal protein S8e family p... Potri.001G262100 16.49 0.8828 RPS8.3
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Potri.017G101000 22.71 0.8817 Pt-RPL7.7
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Potri.006G136500 24.85 0.8718 TIF3.2
AT2G34050 unknown protein Potri.004G052200 25.69 0.8114
AT5G39850 Ribosomal protein S4 (.1) Potri.016G076500 30.74 0.8634
AT3G02560 Ribosomal protein S7e family p... Potri.016G100400 31.43 0.8755
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Potri.008G050200 31.46 0.8738
AT2G09990 Ribosomal protein S5 domain 2-... Potri.001G304700 43.47 0.8664 RPS16.3
AT5G56670 Ribosomal protein S30 family p... Potri.015G084700 44.09 0.8553 RPS30.1

Potri.007G072900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.