Potri.007G074101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23300 281 / 3e-94 PYRD pyrimidine d (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G089700 309 / 5e-105 AT5G23300 751 / 0.0 pyrimidine d (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024096 295 / 6e-100 AT5G23300 672 / 0.0 pyrimidine d (.1)
Lus10041623 270 / 9e-90 AT5G23300 650 / 0.0 pyrimidine d (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0036 TIM_barrel PF01180 DHO_dh Dihydroorotate dehydrogenase
Representative CDS sequence
>Potri.007G074101.1 pacid=42765847 polypeptide=Potri.007G074101.1.p locus=Potri.007G074101 ID=Potri.007G074101.1.v4.1 annot-version=v4.1
ATGCTTCAGGGAAGAAAGCAATTAAAGGAGCTAGTTAAGAAGGTCCAAGCTGCTCGTGATGAAATGCAATGGGGTGAGGAGGGTCCTCCTCCTTTGCTTG
TGAAAATTGCTCCTGACTTGTCCAAGGAAGACCTTGAAGACATTGCAGCAGTTTCTCTTGCACTCCGCTTGGATGGACTGAAGATGATGTTTTCATGCAG
TTCAATAATAGCAATAATTATATCAAATACAACAATATCAAGGCCAGATTTTGTAAAGAAATACCCAGTGGCTGAGGAAACTGGTGGCTTGAGTGGGAAA
CCTCTCCTCAATTTGTCTACCAATATCTTAAAAGAGATGTATATTTTGACAAGGGGGAAGATTCCTTTGATAGGCTGTGGAGGTGTTTTCAGTGGTGAGG
ATGCATACAAAAAAATTCGAGCTGGAGCAACACTTGTTCAGCTTTATACAGGATTTGCCTATGGGGGACCAGCCCTGATTCCTCGAATGAAGGCTGAGCT
GGTCGAGTGCTTAGAAAGGGATGGTTTCAAGTCTATTTTGGAGGCAGTTGGTGCAGATTACAGATAG
AA sequence
>Potri.007G074101.1 pacid=42765847 polypeptide=Potri.007G074101.1.p locus=Potri.007G074101 ID=Potri.007G074101.1.v4.1 annot-version=v4.1
MLQGRKQLKELVKKVQAARDEMQWGEEGPPPLLVKIAPDLSKEDLEDIAAVSLALRLDGLKMMFSCSSIIAIIISNTTISRPDFVKKYPVAEETGGLSGK
PLLNLSTNILKEMYILTRGKIPLIGCGGVFSGEDAYKKIRAGATLVQLYTGFAYGGPALIPRMKAELVECLERDGFKSILEAVGADYR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G23300 PYRD pyrimidine d (.1) Potri.007G074101 0 1
AT5G23300 PYRD pyrimidine d (.1) Potri.007G074201 1.00 0.8409
AT2G01850 ATXTH27, EXGT-A... XYLOGLUCAN ENDOTRANSGLUCOSYLAS... Potri.002G153200 5.47 0.7442
AT1G01730 unknown protein Potri.002G158500 5.47 0.6944
AT3G23940 dehydratase family (.1.2) Potri.001G051700 6.92 0.7261
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Potri.013G091400 9.79 0.7504
AT1G78560 Sodium Bile acid symporter fam... Potri.011G103200 10.39 0.7386
AT2G44930 Plant protein of unknown funct... Potri.017G019400 12.00 0.7552
AT5G05330 HMG-box (high mobility group) ... Potri.019G049100 15.65 0.7434
AT1G78172 unknown protein Potri.002G096200 15.96 0.7523
AT5G03050 unknown protein Potri.014G110300 16.73 0.7147

Potri.007G074101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.