Potri.007G074700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47000 358 / 1e-123 Peroxidase superfamily protein (.1)
AT4G17690 353 / 1e-121 Peroxidase superfamily protein (.1)
AT4G37530 330 / 2e-112 Peroxidase superfamily protein (.1.2)
AT1G24110 327 / 1e-111 Peroxidase superfamily protein (.1)
AT4G37520 327 / 2e-111 Peroxidase superfamily protein (.1.2)
AT5G40150 325 / 9e-111 Peroxidase superfamily protein (.1)
AT3G28200 319 / 1e-108 Peroxidase superfamily protein (.1)
AT3G49960 300 / 6e-101 Peroxidase superfamily protein (.1)
AT5G14130 297 / 6e-100 Peroxidase superfamily protein (.1)
AT5G67400 297 / 1e-99 RHS19 root hair specific 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G076500 363 / 1e-125 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.010G036100 352 / 2e-121 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.001G351000 335 / 1e-114 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.004G052100 316 / 5e-107 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.011G062300 304 / 1e-101 AT2G34060 434 / 1e-152 Peroxidase superfamily protein (.1)
Potri.007G053400 301 / 2e-101 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.017G064100 299 / 1e-100 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.001G329200 298 / 2e-100 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.018G089900 296 / 3e-99 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004234 332 / 3e-113 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10039445 331 / 3e-113 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10042144 330 / 9e-113 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10010716 328 / 8e-112 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10013955 315 / 3e-105 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10001442 303 / 6e-102 AT4G30170 475 / 7e-170 Peroxidase family protein (.1)
Lus10011079 299 / 2e-100 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10005278 303 / 5e-99 AT2G34060 441 / 3e-152 Peroxidase superfamily protein (.1)
Lus10012540 294 / 2e-98 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10032035 283 / 3e-94 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.007G074700.1 pacid=42765638 polypeptide=Potri.007G074700.1.p locus=Potri.007G074700 ID=Potri.007G074700.1.v4.1 annot-version=v4.1
ATGGATAGAGTTCAATTGTGTCTTACCCCAATTTTCTTTCTGGTTTTGGTTCCTTGCGTGGCTAGAGGACCAAATGCACTAGGCCTCAGCTACGATTTCT
ACAATAAGACTTGTCCCAATGTAGAGAAAATCATCCGCAATGTGGTTTCTCAAAAGCTTTTGGAAGCTCCTGTCACCGCTGCTGGTGCTCTTCGCATCTT
CTTCCATGACTGCTTTGTTGAGGGATGTGATGCGTCAGTCTTAATAGCATCAAGGGAGAGCAACAAGGCAGAGAGGGATGCAGAAATAAATCTTTCTTTG
CCAGGAGATGGCTACGATGTCTTCTTCCGAGCCAAGAGAGCTCTAGAGTTGCAATGCCCTGGCTTTGTCTCTTGTGCTGATGTTATGGCCATTGCCACTA
GAGACTTGGTTAACTTGGTGGGAGGGCCAAGGTGGGAAGTGAAGAAGGGGAGAAGAGATGGGCTAATCTCCAAGGCCTCAAGGGTGGACGGCAACCTTCC
TCAGGTGAACCAAACAATCCCTCAACTAATCTCACTTTTCAAATCCAGAGGTCTATCCACCATGGACATGGTGGCCTTATCAGGCGGACACACCATAGGT
TTCTCACATTGCAAGGAATTCATGCCAAGAATCTATGGCTACAACAGCACATTTGACATAGACCCGACAATGAACCAGGAATATGCAAGAACCCTTCGGA
GTCCTTGTCCTCAGAGACATCTTGATCCAACTGTGGTTGCCCTTAATGATGTAACTACACCATTTATTTTTGACAATGCTTATTACCACAACCTTAAAAA
GGGTCTTGGGTTGCTAGCAAGTGACCAGATGTTGGTTTTGGACCCCTTAACTCGAGGTTATGTGGATATGATGGCTGCTGATCAACAACTTTTTTTCAAT
TACTTTGTTGAGTCCATGATAAAGCTAGGCCAAGTTGGAGTCAAGACGGGGAGTGATGGTGAGATTAGAAGACGTTGTGACTCCTTCAATAATTAA
AA sequence
>Potri.007G074700.1 pacid=42765638 polypeptide=Potri.007G074700.1.p locus=Potri.007G074700 ID=Potri.007G074700.1.v4.1 annot-version=v4.1
MDRVQLCLTPIFFLVLVPCVARGPNALGLSYDFYNKTCPNVEKIIRNVVSQKLLEAPVTAAGALRIFFHDCFVEGCDASVLIASRESNKAERDAEINLSL
PGDGYDVFFRAKRALELQCPGFVSCADVMAIATRDLVNLVGGPRWEVKKGRRDGLISKASRVDGNLPQVNQTIPQLISLFKSRGLSTMDMVALSGGHTIG
FSHCKEFMPRIYGYNSTFDIDPTMNQEYARTLRSPCPQRHLDPTVVALNDVTTPFIFDNAYYHNLKKGLGLLASDQMLVLDPLTRGYVDMMAADQQLFFN
YFVESMIKLGQVGVKTGSDGEIRRRCDSFNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47000 Peroxidase superfamily protein... Potri.007G074700 0 1
AT5G04370 NAMT1 S-adenosyl-L-methionine-depend... Potri.019G022200 3.74 0.9428
AT1G75580 SAUR-like auxin-responsive pro... Potri.005G237200 9.16 0.9416 SAUR31
AT1G14820 Sec14p-like phosphatidylinosit... Potri.010G105400 12.00 0.9411
AT1G29670 GDSL-like Lipase/Acylhydrolase... Potri.019G008000 15.23 0.9396
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Potri.009G051300 16.97 0.9213
AT2G42840 PDF1 protodermal factor 1 (.1) Potri.002G060800 25.98 0.9334
Potri.007G016532 27.82 0.9230
AT3G20820 Leucine-rich repeat (LRR) fami... Potri.003G207000 33.10 0.8638 Pt-PGI.2
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Potri.011G140600 34.29 0.9301
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Potri.018G099201 36.22 0.9047

Potri.007G074700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.