Plant FIBer expression Database

Potri.007G076750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G076750.1 pacid=42766266 polypeptide=Potri.007G076750.1.p locus=Potri.007G076750 ID=Potri.007G076750.1.v4.1 annot-version=v4.1
ATGTTCTTCCAGAAACAAATTAGTTCAAGAAATTATTATCATTTGTACAATTTATATGTCAAATGCCCCATTGGATCTGGTGTTTATGATGGATCATCAA
AGGTTTTGACCGATACTGATCAGCAAAATACAAAATGCAGAGAAGACAGAATAAAGGTGGTCCAAAGCTATATTCAAATGCTGATGCTTTCTAATAGTAT
AGACCTAAAGACTCAGATTTCTTATGACTCGGGCAAAGCATATGCGTGTACTGTTATTAAAGGAGAAAAATATCTGACCAATATATATATATATATATAT
ATATATGACCAGTCAAAAAGCTAG
AA sequence
>Potri.007G076750.1 pacid=42766266 polypeptide=Potri.007G076750.1.p locus=Potri.007G076750 ID=Potri.007G076750.1.v4.1 annot-version=v4.1
MFFQKQISSRNYYHLYNLYVKCPIGSGVYDGSSKVLTDTDQQNTKCREDRIKVVQSYIQMLMLSNSIDLKTQISYDSGKAYACTVIKGEKYLTNIYIYIY
IYDQSKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G076750
[exp]
0 1
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Potri.007G012100
[exp]
7.21 0.6204
AT1G68510 AS2 LBD42 LOB domain-containing protein ... Potri.008G120600
[exp]
14.83 0.5518
AT5G42567 Protein of unknown function (D... Potri.018G045250
[exp]
18.30 0.5337
AT4G20820 FAD-binding Berberine family p... Potri.001G461700
[exp]
21.35 0.5330
ATCG00670 PCLPP, ATCG0067... CASEINOLYTIC PROTEASE P 1, pla... Potri.002G178801
[exp]
22.84 0.5392
AT4G32150 ATVAMP711, VAMP... vesicle-associated membrane pr... Potri.018G125900
[exp]
27.62 0.5300
AT1G04645 Plant self-incompatibility pro... Potri.018G148630
[exp]
31.32 0.5300
AT1G51600 GATA GATA28, TIFY2A,... GATA TRANSCRIPTION FACTOR 28, ... Potri.017G042300
[exp]
32.01 0.4665
AT4G38040 Exostosin family protein (.1) Potri.012G091600
[exp]
38.66 0.5108
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Potri.010G044500
[exp]
41.29 0.5248

Potri.007G076750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.