Plant FIBer expression Database

Potri.007G078000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G078000.1 pacid=42765321 polypeptide=Potri.007G078000.1.p locus=Potri.007G078000 ID=Potri.007G078000.1.v4.1 annot-version=v4.1
ATGGGGAAAATCCTCGTGGTTTCAGGGTTAGAAAATGTCGCAAATGCTTACAGATTTACCAAATTCCAGAGGAACAGGAGTAAGCTGCTATGTTCTTGGA
GGGGAAGGAAAGCATTTGGTTTCAGGGCTTTAACCACACCATCTACCCATCGAGGCTCTCCATCCTTTTATCACCACCTCCCAATCGAAGCTCTCACACA
ACAACCCAAACCAGTACCCATAATCATAGCACTTGGAACAAACCACCATTTCCTCATTTTTCCACTCAGAAACCCTAATGTTTCAAGTGCGGTATCCATA
TTTTCCTGTCATCAATGCAAAGGGAAGGATTTAAATAGTCTTGAGTCTTAG
AA sequence
>Potri.007G078000.1 pacid=42765321 polypeptide=Potri.007G078000.1.p locus=Potri.007G078000 ID=Potri.007G078000.1.v4.1 annot-version=v4.1
MGKILVVSGLENVANAYRFTKFQRNRSKLLCSWRGRKAFGFRALTTPSTHRGSPSFYHHLPIEALTQQPKPVPIIIALGTNHHFLIFPLRNPNVSSAVSI
FSCHQCKGKDLNSLES

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G078000
[exp]
0 1
AT1G43980 Tetratricopeptide repeat (TPR)... Potri.005G185300
[exp]
22.44 0.6176
AT1G16610 RNPS1, SR45 arginine/serine-rich 45 (.1.2.... Potri.011G143100
[exp]
30.85 0.6039 SR45.1
AT5G57590 BIO1 biotin auxotroph 1, adenosylme... Potri.006G170400
[exp]
36.46 0.5621
AT5G07900 Mitochondrial transcription te... Potri.003G190400
[exp]
36.60 0.6108
AT2G04560 AtLpxB lipid X B, transferases, trans... Potri.014G160300
[exp]
43.11 0.5983
AT5G62600 MOS14 modifier of snc1-1, 14, ARM re... Potri.012G073600
[exp]
43.57 0.5999
AT1G24510 TCP-1/cpn60 chaperonin family ... Potri.010G051700
[exp]
54.68 0.5705
AT2G25970 KH domain-containing protein (... Potri.018G055300
[exp]
67.11 0.5510
AT4G24240 WRKY ATWRKY7, WRKY7 WRKY DNA-binding protein 7 (.1... Potri.002G123300
[exp]
67.97 0.5442
AT1G29350 Kinase-related protein of unkn... Potri.011G078800
[exp]
82.14 0.5705

Potri.007G078000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.