Potri.007G079600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10500 209 / 7e-70 ATCPISCA chloroplast-localized ISCA-like protein (.1)
AT2G16710 77 / 2e-18 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
AT5G03905 74 / 5e-17 Iron-sulphur cluster biosynthesis family protein (.1)
AT2G36260 71 / 4e-16 Iron-sulphur cluster biosynthesis family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G085400 229 / 1e-77 AT1G10500 227 / 9e-77 chloroplast-localized ISCA-like protein (.1)
Potri.010G238800 76 / 6e-18 AT2G16710 211 / 2e-71 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Potri.008G020400 74 / 5e-17 AT2G16710 197 / 5e-66 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Potri.006G084300 74 / 8e-17 AT5G03905 199 / 2e-66 Iron-sulphur cluster biosynthesis family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012683 208 / 2e-69 AT1G10500 218 / 2e-73 chloroplast-localized ISCA-like protein (.1)
Lus10020827 207 / 6e-69 AT1G10500 216 / 1e-72 chloroplast-localized ISCA-like protein (.1)
Lus10022714 72 / 3e-16 AT5G03905 201 / 3e-67 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10014201 70 / 3e-15 AT5G03905 204 / 2e-68 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10017048 66 / 7e-14 AT2G16710 220 / 5e-75 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Lus10021368 59 / 1e-10 AT2G16710 211 / 3e-69 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis
Representative CDS sequence
>Potri.007G079600.2 pacid=42765185 polypeptide=Potri.007G079600.2.p locus=Potri.007G079600 ID=Potri.007G079600.2.v4.1 annot-version=v4.1
ATGGCGTTATTCTCTTCAACAACAGCACCACCGTACTCTCCTCCTCTTCTCCGATTACCAGATTACACTAATAAAAAAACTCTCTCTTTCTCTTCTCCTC
CAAATTCTCTCTCTTTCCGATTCTCCACATCGAATCTCAGCCGTCGAAACCCTTCTCTTTCTCTTCGATCAACTTCATCCCTAGCTTCGCCGCCGTTGGA
GGGGGTGGCGCCGGCTATATCGGTGACGGAGAATGCGTTGAAGCATTTGAATAGGATAAAAAATGAGAGAAATGAAGATCTGTGCTTAAGAATTGGGGTT
AAACAAGGTGGATGCTCTGGTATGTCTTACACTATGGATTTTGAGAATCGAGCCAATGCTAGACCCGATGATTCCATCATTGAATGTAACGGATTTGTAA
TTGTTTGTGATCCGAAGAGCCTCCTCTTCATATTTGGGATGCAATTGGATTACAGTGATGCTCTTATCGGTGGAGGTTTCTCTTTCAAGAACCCAAATGC
TACAAAGACATGTGGCTGTGGTAAATCCTTTGCAGCATAG
AA sequence
>Potri.007G079600.2 pacid=42765185 polypeptide=Potri.007G079600.2.p locus=Potri.007G079600 ID=Potri.007G079600.2.v4.1 annot-version=v4.1
MALFSSTTAPPYSPPLLRLPDYTNKKTLSFSSPPNSLSFRFSTSNLSRRNPSLSLRSTSSLASPPLEGVAPAISVTENALKHLNRIKNERNEDLCLRIGV
KQGGCSGMSYTMDFENRANARPDDSIIECNGFVIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATKTCGCGKSFAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G10500 ATCPISCA chloroplast-localized ISCA-lik... Potri.007G079600 0 1
AT4G22260 IM1, IM IMMUTANS, Alternative oxidase ... Potri.011G021800 1.41 0.9748
AT5G27280 Zim17-type zinc finger protein... Potri.005G246200 1.41 0.9737
AT4G37000 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOR... Potri.007G043600 2.00 0.9697
AT5G16370 AAE5 acyl activating enzyme 5 (.1) Potri.019G067800 2.64 0.9639
AT3G13540 MYB ATMYB5, ATM2 myb domain protein 5 (.1) Potri.013G056500 3.46 0.9665
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Potri.001G093300 3.87 0.9673
AT1G48450 Protein of unknown function (D... Potri.015G031200 4.24 0.9597
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.005G079600 5.83 0.9506 Pt-ACT11.10
AT1G79510 Uncharacterized conserved prot... Potri.010G173000 6.00 0.9562
AT1G27385 unknown protein Potri.001G056500 6.24 0.9709

Potri.007G079600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.