Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09720 273 / 2e-94 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 271 / 1e-93 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT2G21880 243 / 9e-83 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT3G16100 243 / 1e-82 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT1G52280 242 / 3e-82 AtRABG3d RAB GTPase homolog G3D (.1) AT3G18820 238 / 1e-80 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 237 / 3e-80 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT5G39620 177 / 1e-56 AtRABG1 RAB GTPase homolog G1 (.1) AT5G10260 105 / 1e-28 AtRABH1e RAB GTPase homolog H1E (.1) AT5G59840 104 / 4e-28 Ras-related small GTP-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G062400 [exp] 297 / 4e-104 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 291 / 2e-101 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 289 / 7e-101 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.004G153400 [exp] 243 / 2e-82 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.009G115000 [exp] 242 / 2e-82 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 223 / 2e-74 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 221 / 5e-74 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.005G075300 [exp] 103 / 8e-28 AT5G10260 400 / 2e-144 RAB GTPase homolog H1E (.1) Potri.008G051700 [exp] 101 / 8e-27 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028719 [exp] 285 / 3e-99 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 272 / 3e-94 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10035872 [exp] 242 / 3e-82 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 238 / 1e-80 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 224 / 7e-75 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 218 / 6e-73 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10025790 [exp] 132 / 4e-39 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10043349 [exp] 104 / 4e-28 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10019501 [exp] 104 / 4e-28 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10041702 [exp] 103 / 1e-27 AT5G10260 404 / 7e-146 RAB GTPase homolog H1E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF08477 [poplar] [flax] Roc Ras of Complex, Roc, domain of DAPkinase
Representative CDS sequence Show only first row Show all	>Potri.007G079700.2 pacid=42765738 polypeptide=Potri.007G079702.1.p locus=Potri.007G079700 ID=Potri.007G079700.2.v4.1 annot-version=v4.1 ATGAATCAATATGTATATAACAAGTATAGTCAGCAGTCTAAAGCTACAATTGGTGCTGATTTTGTCACGAAGGAACTGCAGATTGATGACAAGCTGGTCA CTTTGCAAATATGGAACACAGCAGGGCAGGAGAGGTTTCAGAGTTTAGGCCCGGCATTTTACAGAGGGGCAGATTGCTGTGTTCTTGAATATGATGTAAA TGTACAGAAATCATTTGAAACACTTAACAATTGGCATGAAGAATTTCTCAAACAGATGTATCCAGATGATCCTCATGCATTTCCTTTTATATTACTGGGA AACAAAATCGACCTAGATGGTGGTGGAAGCAGCCGAGTTTCAGAGAAAAAAGCCAGAGAATGGTGTGCTTCCATGGGAGGTATACCATGCTTTGAGACCT CAGCAAAAGAGGATTGCAACATTGATGAAGCTTTTCTTTGTGATGCAAAAACTGCACTAGAAGAAGAACATGAACACGAACATTACTTCCAGGGTATATC AGAAACTGTTTCAGAAGCTGAGCAAAGAGGAGGTTGTGCATGTTGA
AA sequence Show only first row Show all	>Potri.007G079700.2 pacid=42765738 polypeptide=Potri.007G079702.1.p locus=Potri.007G079700 ID=Potri.007G079700.2.v4.1 annot-version=v4.1 MNQYVYNKYSQQSKATIGADFVTKELQIDDKLVTLQIWNTAGQERFQSLGPAFYRGADCCVLEYDVNVQKSFETLNNWHEEFLKQMYPDDPHAFPFILLG NKIDLDGGGSSRVSEKKAREWCASMGGIPCFETSAKEDCNIDEAFLCDAKTALEEEHEHEHYFQGISETVSEAEQRGGCAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Potri.007G079700 [exp]	0	1
AT2G31335			unknown protein		Potri.019G012603 [exp]	8.48	0.7813
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.002G050400 [exp]	9.94	0.7400
AT2G14760	bHLH	bHLH084	basic helix-loop-helix (bHLH) ...		Potri.009G089000 [exp]	11.83	0.7680
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Potri.016G003300 [exp]	12.00	0.7232	FML10
AT3G04900			Heavy metal transport/detoxifi...		Potri.001G326100 [exp]	12.48	0.6926
AT2G22440			unknown protein		Potri.001G266504 [exp]	13.85	0.6558
AT3G45010		SCPL48	serine carboxypeptidase-like 4...		Potri.009G006701 [exp]	16.91	0.6142
AT5G53820			Late embryogenesis abundant pr...		Potri.004G106350 [exp]	21.97	0.6291
					Potri.009G102600 [exp]	33.27	0.5173
					Potri.012G116401 [exp]	43.81	0.5761

Compare expression of checked genes

Potri.007G079700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.