Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39620 122 / 5e-34 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G48730 47 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G27270 43 / 9e-06 EMB976 EMBRYO DEFECTIVE 976, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G41720 42 / 2e-05 EMB2654 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G73710 40 / 0.0001 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G18940 40 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G53700 39 / 0.0002 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G51965 39 / 0.0002 ABO5 ABA Overly-Sensitive 5 (.1) AT4G31850 39 / 0.0004 PGR3 proton gradient regulation 3 (.1) AT2G15820 39 / 0.0004 OTP51 ORGANELLE TRANSCRIPT PROCESSING 51, endonucleases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G082400 [exp] 137 / 1e-39 AT4G39620 625 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.012G123600 [exp] 46 / 9e-07 AT2G35130 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.008G142900 [exp] 45 / 2e-06 AT5G13770 544 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.019G103400 [exp] 42 / 2e-05 AT1G03560 911 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G243000 [exp] 42 / 2e-05 AT2G30780 84 / 4e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G105000 [exp] 42 / 2e-05 AT1G51965 855 / 0.0 ABA Overly-Sensitive 5 (.1) Potri.006G166200 [exp] 42 / 3e-05 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G297300 [exp] 41 / 5e-05 AT5G02860 1129 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G058300 [exp] 41 / 5e-05 AT3G53170 618 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036633 [exp] 125 / 2e-37 AT4G39620 218 / 9e-69 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10035850 [exp] 125 / 5e-35 AT4G39620 579 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10024893 [exp] 49 / 1e-07 AT3G53170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016476 [exp] 45 / 2e-06 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022787 [exp] 45 / 3e-06 AT5G48730 687 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040756 [exp] 45 / 3e-06 AT3G46870 349 / 2e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10011849 [exp] 43 / 1e-05 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002107 [exp] 42 / 2e-05 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013894 [exp] 42 / 3e-05 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033110 [exp] 41 / 7e-05 AT1G18900 1091 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.007G084750.1 pacid=42765510 polypeptide=Potri.007G084750.1.p locus=Potri.007G084750 ID=Potri.007G084750.1.v4.1 annot-version=v4.1 ATGACTGTTCTCAAATTTACAATCCCACTTCGCACGCATCACTTGAAATTAAATGAAAGGTTGTTTACTCACAAGGTAAATGTTCAGGTGTTCAGATGGG TGCAGAAACAACGGTGGTATGTAGCCGATAATGGTTGCTGTTATTCAAAGTTGATATCAGTTATGGGAAAGAAAGATCAAACCCGGATGGCTATGTGGCT CTTTTCTGAGATGCGTGACAGTGGATGCCGGCCAGGTACTCCAGTCTACAATGCACTCATCACAGCTCAACTTCACTCTAAAGATAAAACTAAGACTTTG ACTAAAGGCTGGATGCATCCAAATAATTGA
AA sequence Show only first row Show all	>Potri.007G084750.1 pacid=42765510 polypeptide=Potri.007G084750.1.p locus=Potri.007G084750 ID=Potri.007G084750.1.v4.1 annot-version=v4.1 MTVLKFTIPLRTHHLKLNERLFTHKVNVQVFRWVQKQRWYVADNGCCYSKLISVMGKKDQTRMAMWLFSEMRDSGCRPGTPVYNALITAQLHSKDKTKTL TKGWMHPNN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Potri.007G084750 [exp]	0	1
					Potri.017G147700 [exp]	8.94	0.8626
AT5G10970	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.018G021400 [exp]	9.11	0.8881
AT2G22540	MADS	AGL22, SVP	SHORT VEGETATIVE PHASE, AGAMOU...		Potri.007G115200 [exp]	11.40	0.8822	MADS1.5
AT3G23290		LSH4	LIGHT SENSITIVE HYPOCOTYLS 4, ...		Potri.011G156600 [exp]	11.66	0.8745
					Potri.001G425366 [exp]	16.34	0.8752
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Potri.002G208444 [exp]	20.97	0.8710
AT5G14345		AtENODL21	early nodulin-like protein 21 ...		Potri.015G114600 [exp]	23.32	0.7812
AT2G36470			Plant protein of unknown funct...		Potri.004G098000 [exp]	23.36	0.8407
					Potri.015G143650 [exp]	24.61	0.8691
AT1G06330			Heavy metal transport/detoxifi...		Potri.011G065600 [exp]	26.73	0.8214

Compare expression of checked genes

Potri.007G084750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.