Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15100 74 / 3e-17 RHA2A RING-H2 finger A2A (.1) AT2G04240 70 / 1e-15 XERICO RING/U-box superfamily protein (.1.2) AT1G72310 71 / 5e-15 ATL3 RING/U-box superfamily protein (.1) AT1G63840 67 / 2e-14 RING/U-box superfamily protein (.1) AT3G61460 67 / 3e-14 BRH1 brassinosteroid-responsive RING-H2 (.1) AT2G01150 64 / 2e-13 RHA2B RING-H2 finger protein 2B (.1) AT2G17450 64 / 3e-13 RHA3A RING-H2 finger A3A (.1) AT1G49200 65 / 5e-13 RING/U-box superfamily protein (.1) AT5G41400 63 / 8e-13 RING/U-box superfamily protein (.1) AT3G16720 64 / 1e-12 ATL2 TOXICOS EN LEVADURA 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G081300 [exp] 240 / 2e-82 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1) Potri.007G086100 [exp] 196 / 4e-65 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1) Potri.005G081200 [exp] 155 / 4e-49 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1) Potri.007G086300 [exp] 154 / 1e-48 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1) Potri.008G219200 [exp] 72 / 1e-15 AT3G16720 197 / 2e-61 TOXICOS EN LEVADURA 2 (.1) Potri.003G130900 [exp] 71 / 1e-15 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.001G101000 [exp] 69 / 6e-15 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.019G010500 [exp] 69 / 1e-14 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.010G010500 [exp] 69 / 2e-14 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032290 [exp] 74 / 1e-16 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10019686 [exp] 73 / 2e-16 AT1G72310 62 / 1e-11 RING/U-box superfamily protein (.1) Lus10024657 [exp] 73 / 2e-16 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10016427 [exp] 71 / 9e-16 AT1G72310 59 / 4e-11 RING/U-box superfamily protein (.1) Lus10017510 [exp] 70 / 2e-15 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10028773 [exp] 70 / 3e-15 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10016428 [exp] 67 / 3e-14 AT5G45290 59 / 2e-11 RING/U-box superfamily protein (.1.2) Lus10022743 [exp] 66 / 1e-13 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10016163 [exp] 66 / 2e-13 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1) Lus10019685 [exp] 65 / 2e-13 AT5G43200 62 / 4e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.007G086200.1 pacid=42765619 polypeptide=Potri.007G086200.1.p locus=Potri.007G086200 ID=Potri.007G086200.1.v4.1 annot-version=v4.1 ATGGCAGCTCTCTTGAATGTCTTCCCTCACCTCTACACCATTTCCGTATCCTTCTTCAATCTCTTACTCCTCAAAGCCCTATTTCTAATCCGGTGCTTCG TCCCCGGAAGTGAGGTCGCGAATCCTGATAAACTCTTTCGCATAATTTCCACACAATATCTCAACATCATTGAAAAAACAAATCCAACTCTTCATTACTG TGAAAAAATCACCCGGCCGCGATCAAGAGAATGTGCAGTATGCTTATCGGAATTTACGGAAGGCGAAAGGGTTAGGAAATTGAAATGCCACCACACGTTT CACAATGAATGTTTAGACAAATGGTTACACCAATCCATGGCTACATGCCCGCTTTGCAGGACTGTGGTTTTGCCAGATGAGATTGTGGTCAATTATCATC AGCTGCGAGATAATATACTGAACGGTGGGAGCTATGATGATACCATTTTCTTGTTATCTGCGTTGTATGGCAGTAGTATGAAAAAAATATTCTAA
AA sequence Show only first row Show all	>Potri.007G086200.1 pacid=42765619 polypeptide=Potri.007G086200.1.p locus=Potri.007G086200 ID=Potri.007G086200.1.v4.1 annot-version=v4.1 MAALLNVFPHLYTISVSFFNLLLLKALFLIRCFVPGSEVANPDKLFRIISTQYLNIIEKTNPTLHYCEKITRPRSRECAVCLSEFTEGERVRKLKCHHTF HNECLDKWLHQSMATCPLCRTVVLPDEIVVNYHQLRDNILNGGSYDDTIFLLSALYGSSMKKIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15100		RHA2A	RING-H2 finger A2A (.1)		Potri.007G086200 [exp]	0	1
AT4G23280		CRK20	cysteine-rich RLK (RECEPTOR-li...		Potri.011G027600 [exp]	1.00	0.9921
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Potri.006G247800 [exp]	3.87	0.9648
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.011G027900 [exp]	4.89	0.9819
					Potri.001G259204 [exp]	5.65	0.9538
					Potri.014G065200 [exp]	6.00	0.9755
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.011G027800 [exp]	6.48	0.9733
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.009G098400 [exp]	9.21	0.9527
AT5G37860			Heavy metal transport/detoxifi...		Potri.006G079400 [exp]	9.74	0.9492
AT5G35405			Protein of unknown function (D...		Potri.002G229600 [exp]	9.89	0.9741
AT5G35405			Protein of unknown function (D...		Potri.002G229650 [exp]	10.58	0.9741

Compare expression of checked genes

Potri.007G086200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.