Potri.007G086300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15100 79 / 4e-19 RHA2A RING-H2 finger A2A (.1)
AT2G01150 75 / 1e-17 RHA2B RING-H2 finger protein 2B (.1)
AT3G61460 72 / 3e-16 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT2G04240 70 / 2e-15 XERICO RING/U-box superfamily protein (.1.2)
AT4G00305 68 / 4e-15 RING/U-box superfamily protein (.1)
AT3G16720 71 / 6e-15 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT4G15975 67 / 7e-14 RING/U-box superfamily protein (.1)
AT1G63840 66 / 7e-14 RING/U-box superfamily protein (.1)
AT4G09100 65 / 8e-14 RING/U-box superfamily protein (.1)
AT4G17245 65 / 1e-13 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G081200 272 / 4e-95 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.005G081300 171 / 5e-55 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.007G086100 163 / 4e-52 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.007G086200 154 / 1e-48 AT1G15100 74 / 5e-17 RING-H2 finger A2A (.1)
Potri.010G010500 82 / 4e-19 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.003G130900 78 / 2e-18 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.001G101000 76 / 1e-17 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
Potri.008G185800 72 / 2e-16 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.014G170400 71 / 4e-16 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019686 88 / 3e-22 AT1G72310 62 / 1e-11 RING/U-box superfamily protein (.1)
Lus10016427 82 / 8e-20 AT1G72310 59 / 4e-11 RING/U-box superfamily protein (.1)
Lus10016428 79 / 9e-19 AT5G45290 59 / 2e-11 RING/U-box superfamily protein (.1.2)
Lus10003617 75 / 2e-17 AT2G01150 63 / 6e-13 RING-H2 finger protein 2B (.1)
Lus10019685 74 / 6e-17 AT5G43200 62 / 4e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Lus10028773 74 / 1e-16 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 74 / 1e-16 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 74 / 1e-16 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10013475 71 / 4e-16 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10007936 71 / 5e-16 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.007G086300.1 pacid=42766699 polypeptide=Potri.007G086300.1.p locus=Potri.007G086300 ID=Potri.007G086300.1.v4.1 annot-version=v4.1
ATGGCCTCTCTCTCTGAATTCTTCTCCCACCTCTATACCATGTCCATAGTCTTCCTCAGTCTTCTACTCGTTGAAATTGTAATTCTATTCCAGTCGGTCA
TCGGAAGTACCTTGAAGTCCAATAAACCAATAATTAGCACCACTCAGTATCTTAAACACATGGAAGAAAAAAATCCAACTATTTCTTACAGTGAAAAATT
GACGAGGCAACAAGATTCGATGGAATGTGCTGTCTGTTTGTCCAAATTTTCGGAAGGCGAAAGTGTGAGGAAATTGAATTGCAAACATACATTCCACAAG
GATTGCTTAGACAAATGGTTACAGCAATCTTTGGCTACATGCCCACTTTGCAGGGCTAAGGTTTTGCCAGATGAGATTGTAGCCAAGTATGATCGGATGC
AAAATCAGATAGGGTATGATGGGAGTGACGAGGAGATGGCGCCCTTTTTGCTATCTGCACTACATGGTAATGGTCTGCAAAGAATATTTTAG
AA sequence
>Potri.007G086300.1 pacid=42766699 polypeptide=Potri.007G086300.1.p locus=Potri.007G086300 ID=Potri.007G086300.1.v4.1 annot-version=v4.1
MASLSEFFSHLYTMSIVFLSLLLVEIVILFQSVIGSTLKSNKPIISTTQYLKHMEEKNPTISYSEKLTRQQDSMECAVCLSKFSEGESVRKLNCKHTFHK
DCLDKWLQQSLATCPLCRAKVLPDEIVAKYDRMQNQIGYDGSDEEMAPFLLSALHGNGLQRIF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G15100 RHA2A RING-H2 finger A2A (.1) Potri.007G086300 0 1
Potri.011G041124 4.00 0.7515
AT5G51100 FSD2 Fe superoxide dismutase 2 (.1) Potri.015G110400 9.27 0.7297
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Potri.003G119700 9.32 0.6424
AT1G21340 DOF AtDof1,2 Dof-type zinc finger DNA-bindi... Potri.005G188900 11.48 0.7117
AT2G39740 HESO1 HEN1 suppressor 1, Nucleotidyl... Potri.008G059301 12.88 0.6003
AT5G57510 unknown protein Potri.018G006800 17.88 0.6840
AT5G59030 COPT1 copper transporter 1 (.1) Potri.001G246000 19.44 0.7182
Potri.001G280332 26.11 0.6413
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Potri.007G069300 27.11 0.6625
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Potri.008G023800 32.12 0.6592

Potri.007G086300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.