Potri.007G086750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65180 57 / 4e-11 ENTH/VHS family protein (.1.2)
AT5G10060 41 / 1e-05 ENTH/VHS family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G086700 81 / 8e-20 AT5G65180 438 / 9e-151 ENTH/VHS family protein (.1.2)
Potri.005G080800 73 / 6e-17 AT5G65180 357 / 5e-119 ENTH/VHS family protein (.1.2)
Potri.005G080600 64 / 9e-14 AT5G65180 360 / 2e-120 ENTH/VHS family protein (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G086750.1 pacid=42765563 polypeptide=Potri.007G086750.1.p locus=Potri.007G086750 ID=Potri.007G086750.1.v4.1 annot-version=v4.1
ATGACTGTTGGCAAGATTGCAGTCTCTAGATTGAATCACCAGGTGAATTATACAAGAAGAAAGGAAAGTATTTGGTCACGTTCCCGGAGCCTCAAAGAGG
TAATTCTTGGAGAAGATGCTCCTCCACCCTTGGAGTTCAGCAAAAACCGTTCACGCTCCGTCAAAATTACAAAACGAGATTCACGATCCACTAGAGCGGT
CAGACCAAGGAACTAG
AA sequence
>Potri.007G086750.1 pacid=42765563 polypeptide=Potri.007G086750.1.p locus=Potri.007G086750 ID=Potri.007G086750.1.v4.1 annot-version=v4.1
MTVGKIAVSRLNHQVNYTRRKESIWSRSRSLKEVILGEDAPPPLEFSKNRSRSVKITKRDSRSTRAVRPRN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G65180 ENTH/VHS family protein (.1.2) Potri.007G086750 0 1
AT5G55980 serine-rich protein-related (.... Potri.001G371400 1.41 0.9003
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G186100 5.47 0.8781
AT5G52290 SHOC1 shortage in chiasmata 1 (.1) Potri.012G141100 6.78 0.7423
Potri.002G259500 8.71 0.8763
Potri.008G130950 11.83 0.8646
AT2G20430 RIC6 ROP-interactive CRIB motif-con... Potri.002G035500 12.84 0.8762
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G186000 14.38 0.8604
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 14.49 0.8697
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G182800 16.49 0.8632
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G182166 17.29 0.8472

Potri.007G086750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.