Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77940 207 / 6e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT1G36240 206 / 1e-70 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G18740 204 / 8e-70 RLK902 receptor-like kinase 902, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G080700 [exp] 227 / 7e-79 AT1G77940 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.004G196500 [exp] 216 / 1e-74 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.009G158700 [exp] 216 / 1e-74 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016432 [exp] 215 / 4e-74 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10016431 [exp] 215 / 4e-74 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019682 [exp] 213 / 3e-73 AT1G36240 199 / 1e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019681 [exp] 213 / 5e-73 AT1G36240 201 / 2e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10027926 [exp] 170 / 1e-56 AT1G77940 160 / 1e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10012057 [exp] 155 / 4e-50 AT1G77940 145 / 2e-46 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [poplar] [flax] PELOTA PF01248 [poplar] [flax] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Potri.007G086800.4 pacid=42765047 polypeptide=Potri.007G086800.4.p locus=Potri.007G086800 ID=Potri.007G086800.4.v4.1 annot-version=v4.1 ATGGTGACGGCAAAGAAAACTAAGAAGACCCATGAGAGCATCAACAACAGATTGGCTTTGGTGATGAAGAGTGGAAAGTACACTCTTGGTTACAAAACTG TGCTTAAAACTCTGAGGAGCTCTAAAGGAAAATTGATTTTATTATCAAACAATTGCCCACCTTTGAGGAAATCTGAGATTGAGTATTATGCTATGCTTGC GAAGGTTGGGGTTCATCATTATAATGGAAATAATGTCGACTTGGGAACTGCTTGTGGCAAGTATTTCCGTGTATCTTGCCTGAGCATTATTGATGCAGGT GATTCTGATATTATCAAGACAGTCCCTGGTGATCATTGA
AA sequence Show only first row Show all	>Potri.007G086800.4 pacid=42765047 polypeptide=Potri.007G086800.4.p locus=Potri.007G086800 ID=Potri.007G086800.4.v4.1 annot-version=v4.1 MVTAKKTKKTHESINNRLALVMKSGKYTLGYKTVLKTLRSSKGKLILLSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDAG DSDIIKTVPGDH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.007G086800 [exp]	0	1
AT5G35530			Ribosomal protein S3 family pr...		Potri.006G222100 [exp]	3.60	0.9626
AT5G15610			Proteasome component (PCI) dom...		Potri.004G116700 [exp]	5.91	0.9559
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.005G080700 [exp]	6.24	0.9596
AT3G04840			Ribosomal protein S3Ae (.1)		Potri.008G156300 [exp]	7.21	0.9608	RS3.2
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.008G187000 [exp]	8.94	0.9568
AT4G31460			Ribosomal L28 family (.1)		Potri.018G006900 [exp]	9.32	0.9114
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Potri.002G257200 [exp]	9.94	0.9490	TOM22.1
AT1G67430			Ribosomal protein L22p/L17e fa...		Potri.015G094400 [exp]	11.13	0.9592	RPL17.2
AT4G13170			Ribosomal protein L13 family p...		Potri.002G242600 [exp]	12.00	0.9505	Pt-RPL13.3
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.016G063100 [exp]	14.00	0.9473

Compare expression of checked genes

Potri.007G086800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.