Potri.007G087300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
AT4G08570 176 / 1e-57 Heavy metal transport/detoxification superfamily protein (.1)
AT1G71050 171 / 2e-55 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
AT1G22990 169 / 9e-55 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
AT4G38580 152 / 4e-48 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
AT5G17450 151 / 7e-48 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G66110 150 / 2e-47 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
AT4G35060 135 / 3e-41 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1)
AT1G06330 103 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
AT2G18196 100 / 3e-27 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G079800 260 / 1e-90 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
Potri.002G092200 195 / 4e-65 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
Potri.010G114600 194 / 2e-64 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G167000 192 / 7e-64 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G003700 179 / 1e-58 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
Potri.017G123400 173 / 2e-56 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.009G135300 161 / 1e-51 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Potri.004G175400 159 / 7e-51 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Potri.005G110400 149 / 8e-47 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016436 246 / 4e-85 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019676 244 / 2e-84 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
Lus10022508 217 / 1e-73 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Lus10039419 204 / 2e-68 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 196 / 3e-65 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016708 172 / 7e-56 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Lus10036004 170 / 4e-55 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
Lus10042946 170 / 6e-55 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Lus10028426 168 / 3e-54 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Lus10041879 168 / 3e-54 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.007G087300.1 pacid=42764897 polypeptide=Potri.007G087300.1.p locus=Potri.007G087300 ID=Potri.007G087300.1.v4.1 annot-version=v4.1
ATGGGCGTTAGTGGCACTTTGGAGTTTTTATCTGACTTGGTGGGAAGTGGTGGCCATAAACACAAAAAGAAGCAGTTGCAGACTGTAGAGCTCAAGGTCA
GGATGGACTGTGATGGCTGTGAACTTAAGGTCAAGAATGCCCTTTCTTCAATGAGTGGAGTAAAAAAGGTGGAGATAAACAGAAAACAACAAAGGGTGAC
TGTTTCAGGATATGTTGATTCCAATAAGGTCTTGAAGAAGGCAAAGTCAACAGGGAAAAGGGCAGAGATTTGGCCATATGTTCCTTATAGTTTAGTGGCT
CAACCTTTCGCTACCCAGGCTTATGACAAGAAAGCACCTCCTGGTTATGTCAGGAAAGTAGAGAACACTGCCGCCATAGGCACTGTGACTAGATATGAGG
ACCCCTACACCTCCATGTTCAGCGACGACAACCCAAATGCTTGCTCTATCATGTAA
AA sequence
>Potri.007G087300.1 pacid=42764897 polypeptide=Potri.007G087300.1.p locus=Potri.007G087300 ID=Potri.007G087300.1.v4.1 annot-version=v4.1
MGVSGTLEFLSDLVGSGGHKHKKKQLQTVELKVRMDCDGCELKVKNALSSMSGVKKVEINRKQQRVTVSGYVDSNKVLKKAKSTGKRAEIWPYVPYSLVA
QPFATQAYDKKAPPGYVRKVENTAAIGTVTRYEDPYTSMFSDDNPNACSIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39700 Heavy metal transport/detoxifi... Potri.007G087300 0 1
AT4G22010 SKS4 SKU5 similar 4 (.1) Potri.014G154500 2.00 0.9399
AT3G50120 Plant protein of unknown funct... Potri.003G159300 2.23 0.9483
AT4G13870 WRNEXO, ATWRNEX... Werner syndrome-like exonuclea... Potri.016G028700 2.82 0.9269
AT5G45540 Protein of unknown function (D... Potri.015G107800 3.46 0.9237
AT1G09750 Eukaryotic aspartyl protease f... Potri.002G104600 3.74 0.9089
AT3G50870 GATA GATA18, HAN, MN... MONOPOLE, HANABA TANARU, GATA ... Potri.007G024500 7.21 0.9101 Pt-MNP.1
AT1G53163 unknown protein Potri.011G116600 9.48 0.9070
AT2G37590 DOF AtDof2. 4, ATDO... DNA binding with one finger 2.... Potri.006G084200 9.79 0.9143 Pt-DOF2.3
AT5G46700 TRN2, TET1 TORNADO 2, TETRASPANIN 1, Tetr... Potri.003G093000 10.58 0.9057
AT5G20870 O-Glycosyl hydrolases family 1... Potri.006G216700 10.81 0.9342

Potri.007G087300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.