Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39710 158 / 1e-49 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT5G45680 101 / 1e-27 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT5G48580 67 / 1e-14 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 64 / 1e-13 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT2G43560 55 / 9e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 51 / 1e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 49 / 3e-07 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G25340 48 / 3e-07 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT1G18170 39 / 0.0004 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079700 [exp] 194 / 2e-63 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.001G075500 [exp] 100 / 3e-27 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.002G248200 [exp] 67 / 1e-14 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.014G149400 [exp] 54 / 4e-09 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.007G134600 [exp] 51 / 2e-08 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G129200 [exp] 52 / 3e-08 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.015G130900 [exp] 49 / 2e-07 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.017G017500 [exp] 49 / 3e-07 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.006G033400 [exp] 42 / 4e-05 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022507 [exp] 153 / 1e-47 AT4G39710 270 / 8e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10016811 [exp] 153 / 1e-47 AT4G39710 271 / 5e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10006949 [exp] 102 / 9e-28 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10024735 [exp] 88 / 1e-22 AT5G45680 194 / 1e-63 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10000197 [exp] 77 / 1e-19 AT4G39710 90 / 2e-24 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10025889 [exp] 65 / 4e-14 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10038215 [exp] 65 / 8e-13 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002339 [exp] 62 / 1e-12 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1) Lus10003170 [exp] 61 / 2e-12 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10008359 [exp] 54 / 3e-09 AT2G43560 273 / 1e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.007G087401.1 pacid=42765744 polypeptide=Potri.007G087401.1.p locus=Potri.007G087401 ID=Potri.007G087401.1.v4.1 annot-version=v4.1 ATGCGGACCTCTGGTCCTCATCAAGATAAAGAAACAAATCTGTCTTTGAAGTCCGTTTCTAAGACAAAGAAGTGCTTTCTTGATGTGGGTTTTGGGTCTT TTATCTGCTTCTGGTCAGGTGTGGTGGATGCCCAATATAATGAGCTCATCAATGTCCGTGACACTGCAAGATTTGCTGATGGGATAGTCTTTGACAGAAG CTATAAACGCGGCAGACCTCTCACCATGCGCATTGGTGTTGGAAAGGTCATTGGGAGATTAGATCAGGGAATTCTAGGTGTTGAAGTGGTGCTCTCTATG CAAGAAGGTGGAAAACATAAGCTTCATATTCCTCCCCTGTTAGCATATGGACCAGAACATGCAGGATGCTTCTCAGGTGATTGCAATATCCCTGGCAATT CAACTCTTCTATATGATATCAATTTTGTTCGAGTCTAG
AA sequence Show only first row Show all	>Potri.007G087401.1 pacid=42765744 polypeptide=Potri.007G087401.1.p locus=Potri.007G087401 ID=Potri.007G087401.1.v4.1 annot-version=v4.1 MRTSGPHQDKETNLSLKSVSKTKKCFLDVGFGSFICFWSGVVDAQYNELINVRDTARFADGIVFDRSYKRGRPLTMRIGVGKVIGRLDQGILGVEVVLSM QEGGKHKLHIPPLLAYGPEHAGCFSGDCNIPGNSTLLYDINFVRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39710		PnsL4, FKBP16-2	Photosynthetic NDH subcomplex...		Potri.007G087401 [exp]	0	1
AT5G67400		RHS19	root hair specific 19 (.1)		Potri.007G053400 [exp]	4.24	0.8662
					Potri.001G076600 [exp]	6.92	0.8893
AT5G19820		EMB2734	embryo defective 2734, ARM rep...		Potri.017G137400 [exp]	7.07	0.8473
AT1G51140	bHLH	bHLH122	basic helix-loop-helix (bHLH) ...		Potri.001G017300 [exp]	8.06	0.8606
					Potri.002G153750 [exp]	12.72	0.8168
AT4G09660			unknown protein		Potri.014G176225 [exp]	14.17	0.8836
AT5G23980		FRO2, ATFRO4, F...	ferric reduction oxidase 4 (.1...		Potri.017G142800 [exp]	14.66	0.8293	FRO2.1
AT4G34830		PDE346, MRL1	PIGMENT DEFECTIVE 346, MATURAT...		Potri.004G166600 [exp]	16.73	0.8834
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G020500 [exp]	22.44	0.8526
					Potri.008G036000 [exp]	25.37	0.8439

Compare expression of checked genes

Potri.007G087401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.