Potri.007G091100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39730 201 / 2e-66 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT2G22170 199 / 5e-66 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT5G65158 142 / 2e-44 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
AT5G07190 44 / 1e-05 ATS3 seed gene 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G076900 283 / 5e-99 AT2G22170 214 / 6e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.005G077000 249 / 9e-86 AT4G39730 218 / 3e-73 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.007G091000 239 / 5e-82 AT2G22170 216 / 1e-72 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Potri.003G107100 181 / 1e-58 AT4G39730 166 / 1e-52 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037491 208 / 3e-69 AT2G22170 221 / 3e-74 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Lus10006497 208 / 3e-69 AT2G22170 219 / 1e-73 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
Lus10009020 174 / 1e-55 AT2G22170 186 / 2e-60 Lipase/lipooxygenase, PLAT/LH2 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0321 PLAT PF01477 PLAT PLAT/LH2 domain
Representative CDS sequence
>Potri.007G091100.1 pacid=42765579 polypeptide=Potri.007G091100.1.p locus=Potri.007G091100 ID=Potri.007G091100.1.v4.1 annot-version=v4.1
ATGTCATTCCGCCCTCTCCTCCTCCCTCTCCTCCTCCTCCTTTCCTTCTCCTCTATAGTATTTTCTGATGAAGACTGCGTATACACAATGTACGTAAGAA
CAGGATCCATTATCAAAGGAGGCACGGACTCCATCATAAGCGCGACACTGTACGACACTTATGGTTATGGCGTGGAGGTCCCAGATCTTGAGAGATGGGG
AGGGCTAATGGAGCCAGGCCACAACTACTTCGAGAGGGGCAATTTGGACATTTTCAGTGGGAGAGGACCATGTTTGAATGCACCTGTGTGCGCCTTGAAC
TTGACCTCTGATGGGTCAGGTTCAGGCCATGGTTGGTACGTTAACTACGTGGAGGTGACGACAACAGGGGTCCATGCGGCTTGTGCACAAAAGAAGTTCG
AGATTGAGCAATGGCTGGCCCTTGATACTTCGCCTTATAGCTTAATTGCTTTTAGGGATTATTGTGATTATCTTGATGTTAAGAAATCCGCCGGAAGCTC
TTCTATGTAA
AA sequence
>Potri.007G091100.1 pacid=42765579 polypeptide=Potri.007G091100.1.p locus=Potri.007G091100 ID=Potri.007G091100.1.v4.1 annot-version=v4.1
MSFRPLLLPLLLLLSFSSIVFSDEDCVYTMYVRTGSIIKGGTDSIISATLYDTYGYGVEVPDLERWGGLMEPGHNYFERGNLDIFSGRGPCLNAPVCALN
LTSDGSGSGHGWYVNYVEVTTTGVHAACAQKKFEIEQWLALDTSPYSLIAFRDYCDYLDVKKSAGSSSM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39730 Lipase/lipooxygenase, PLAT/LH2... Potri.007G091100 0 1
AT1G13380 Protein of unknown function (D... Potri.010G124800 4.69 0.8070
AT5G65260 RNA-binding (RRM/RBD/RNP motif... Potri.001G311600 4.89 0.7720
AT2G18110 Translation elongation factor... Potri.009G018600 6.92 0.7831
AT1G12845 unknown protein Potri.017G060400 12.72 0.7664
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.001G295902 13.78 0.7945
Potri.015G099100 16.24 0.7539
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 16.61 0.8032
AT5G17190 unknown protein Potri.008G133600 16.97 0.7477
AT3G21690 MATE efflux family protein (.1... Potri.011G002800 18.00 0.7020
AT4G35100 SIMIP, PIP3A, P... PLASMA MEMBRANE INTRINSIC PROT... Potri.009G136600 18.00 0.7344

Potri.007G091100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.