Potri.007G091300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39740 310 / 1e-106 HCC2 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
AT3G08950 159 / 6e-47 HCC1 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G076700 408 / 2e-145 AT4G39740 328 / 1e-113 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Potri.016G118700 179 / 2e-54 AT3G08950 352 / 1e-121 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016805 319 / 4e-110 AT4G39740 328 / 9e-114 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Lus10002848 105 / 4e-28 AT3G08950 170 / 4e-53 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Lus10022501 52 / 2e-08 AT4G39740 76 / 3e-17 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02630 SCO1-SenC SCO1/SenC
Representative CDS sequence
>Potri.007G091300.1 pacid=42765260 polypeptide=Potri.007G091300.1.p locus=Potri.007G091300 ID=Potri.007G091300.1.v4.1 annot-version=v4.1
ATGCCCATTTCTCGCTTTCTTTCCTTTTCCTCCAAATACCGCCCAAGACAGGCTCTCAATCTACTTGAAAGGCTTGGTCCATCTAAGAGGGTTCAATCGA
GTAATCTTTCAAAATCAACAAGACAGAATAACGGGAAGCTGGATGTTCGTCTTGTAGAACAAGTACAAGTCGAACCACGGGTTCCTCGCTCCTATGCCAT
TCCAGCTGCTATACTCGGATTTGCTGGATTGGCAGCTTTTGTGCATTATAATGATGAGAGGCGAGCAGTTCCAAAAGGTCAAGGCAGTGATCGTGGCAAT
GTCAAGGGTCCGACTATTGGTGGTCCGTTCACCCTAATTAACACAGAGGATAAAGTAGTTACTGGGAAAGACTTTCTAGGAAGTTGGGTCTTGCTGTACT
TTGGCTATACATCCTCCCCTGATGTTGGGCCTGAGCAACTGAAAGTGATGGCCAAGGCCATAAACACATTAGAGTCTAAAGCGAATCTCAAGGTTTTGCC
AGTGTTTGTCACACTTGATCCTCAGCGTGACAATCCCTCTCATCTTCGTGCTTACCTTAAAGAGTTTGAACCAAGAATAGTAGGATTAACAGGATCTGTG
GGTGCTATAAGGCAGATGGCACAAGAGTACCGTGTTTATTTCAGGAAAATTGAAGAGGAAGGAGAAGATTATCTTGTTGAGTCTTCTCATGACATGTATT
TCATCAATCCAAACATGGAGGTGGTAAGATGCTTTGGCGTCGAGTATAATGCAGAGGAGCTATCAGAAGCAATACAAAAGGAATTGAAGAGAACCTCGGC
TTGA
AA sequence
>Potri.007G091300.1 pacid=42765260 polypeptide=Potri.007G091300.1.p locus=Potri.007G091300 ID=Potri.007G091300.1.v4.1 annot-version=v4.1
MPISRFLSFSSKYRPRQALNLLERLGPSKRVQSSNLSKSTRQNNGKLDVRLVEQVQVEPRVPRSYAIPAAILGFAGLAAFVHYNDERRAVPKGQGSDRGN
VKGPTIGGPFTLINTEDKVVTGKDFLGSWVLLYFGYTSSPDVGPEQLKVMAKAINTLESKANLKVLPVFVTLDPQRDNPSHLRAYLKEFEPRIVGLTGSV
GAIRQMAQEYRVYFRKIEEEGEDYLVESSHDMYFINPNMEVVRCFGVEYNAEELSEAIQKELKRTSA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39740 HCC2 homologue of copper chaperone ... Potri.007G091300 0 1
AT1G61670 Lung seven transmembrane recep... Potri.016G137700 3.87 0.8305
AT3G15395 unknown protein Potri.001G402000 5.19 0.8390
AT1G43190 PTB3 polypyrimidine tract-binding p... Potri.005G194700 6.78 0.7554
AT5G02780 GSTL1 glutathione transferase lambda... Potri.010G214800 9.16 0.8150
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Potri.018G096077 14.42 0.8341
AT1G01910 P-loop containing nucleoside t... Potri.002G152500 15.00 0.7970
AT4G21192 Cytochrome c oxidase biogenesi... Potri.004G227500 23.23 0.7706
AT5G47830 unknown protein Potri.002G123400 23.32 0.8092
AT5G05830 RING/FYVE/PHD zinc finger supe... Potri.008G062600 26.72 0.7795
AT5G25760 PEX4, UBC21 ubiquitin-conjugating enzyme 2... Potri.018G039200 28.00 0.8113

Potri.007G091300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.