Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ATGB3.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65270 405 / 1e-145 AtRABA4a RAB GTPase homolog A4A (.1) AT4G39990 365 / 4e-130 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT3G12160 345 / 6e-122 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT5G47960 330 / 3e-116 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT4G18800 274 / 4e-94 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT1G16920 274 / 4e-94 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT1G09630 274 / 5e-94 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G07410 272 / 3e-93 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G60860 270 / 1e-92 AtRABA1f RAB GTPase homolog A1F (.1) AT5G45750 269 / 5e-92 AtRABA1c RAB GTPase homolog A1C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G073000 [exp] 445 / 1e-161 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.001G270100 [exp] 338 / 5e-119 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.006G057700 [exp] 332 / 8e-117 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.016G050400 [exp] 327 / 7e-115 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.003G004100 [exp] 279 / 6e-96 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.006G000300 [exp] 278 / 1e-95 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.014G102200 [exp] 278 / 2e-95 AT1G01200 332 / 2e-116 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1) Potri.010G197200 [exp] 276 / 5e-95 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.002G175700 [exp] 272 / 6e-93 AT1G01200 333 / 4e-117 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023153 [exp] 400 / 1e-143 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10000637 [exp] 400 / 2e-143 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10025738 [exp] 395 / 8e-142 AT5G65270 404 / 4e-145 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 395 / 8e-142 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1) Lus10012032 [exp] 328 / 2e-115 AT3G12160 379 / 1e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10016284 [exp] 326 / 2e-114 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10021023 [exp] 323 / 2e-108 AT3G12160 384 / 3e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10023829 [exp] 315 / 7e-108 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10002725 [exp] 301 / 3e-104 AT5G47960 334 / 1e-117 SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) Lus10014732 [exp] 300 / 7e-104 AT5G47960 332 / 6e-117 SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.007G096000.1 pacid=42764933 polypeptide=Potri.007G096000.1.p locus=Potri.007G096000 ID=Potri.007G096000.1.v4.1 annot-version=v4.1 ATGGCTAGTGGGGGTGGATACGGAGATGCGAGCCAGAAGATAGACTATGTATTCAAGGTGGTGTTGATAGGGGACTCAGCAGTTGGGAAATCACAAATAC TTGCTCGATTTGCTAGAAACGAGTTTAGTCTTGACTCTAAAGCTACTATTGGGGTCGAGTTTCAAACTCGGACTCTTGTTATTGATCATAAGAGTGTTAA GGCCCAGATCTGGGATACTGCTGGTCAAGAACGGTATAGAGCAGTCACAAGTGCATACTACAGGGGTGCTGTTGGGGCAATGCTGGTGTATGACATAACC AAGCGTCAGACCTTTGATCACATACCACGCTGGCTGGAAGAGCTGCGAAACCATGCTGACAAGAACATAGTTATCATTTTGATTGGGAACAAAAGTGATC TTGAGGACCAGCGGGCTGTACCCACTGAGGATGCCAAAGAATTTGCCCAGAAGGAAGGACTATTCTTCTTAGAGACCTCTGCATTGCAAGCAACTAATGT TGAGAATGCCTTTATGACTGTGCTGACAGAGATCTTCAACATTGTAAACAAGAAGAACCTGGTTGCTGGTGAAGATCAAATCAATGGTAACCCCGCATCG CTATCTGGCAAGAAGATTATCATTCCAGGCCCTGCACAAGAAATTCCAGCGAAGAGCAAGTGTTGTAGCTAA
AA sequence Show only first row Show all	>Potri.007G096000.1 pacid=42764933 polypeptide=Potri.007G096000.1.p locus=Potri.007G096000 ID=Potri.007G096000.1.v4.1 annot-version=v4.1 MASGGGYGDASQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT KRQTFDHIPRWLEELRNHADKNIVIILIGNKSDLEDQRAVPTEDAKEFAQKEGLFFLETSALQATNVENAFMTVLTEIFNIVNKKNLVAGEDQINGNPAS LSGKKIIIPGPAQEIPAKSKCCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G65270		AtRABA4a	RAB GTPase homolog A4A (.1)		Potri.007G096000 [exp]	0	1	Pt-ATGB3.4
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.014G116500 [exp]	9.11	0.9227	Pt-ARF1.1
AT3G12110		ACT11	actin-11 (.1)		Potri.010G204300 [exp]	12.32	0.9169	ACT5,Pt-PEAC14.3
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.013G123600 [exp]	14.28	0.9141	Pt-RAB11.8
AT5G57330			Galactose mutarotase-like supe...		Potri.001G037700 [exp]	17.32	0.9100
AT4G39860			unknown protein		Potri.007G092400 [exp]	18.33	0.8695
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.019G092500 [exp]	19.49	0.9132	RAB11.11
AT3G12110		ACT11	actin-11 (.1)		Potri.008G055500 [exp]	20.19	0.9133	ACT4,Pt-PEAC14.2
AT3G49720			unknown protein		Potri.001G288200 [exp]	24.65	0.8941
AT5G48020			2-oxoglutarate (2OG) and Fe(II...		Potri.001G271100 [exp]	26.07	0.8973
AT2G43640			Signal recognition particle, S...		Potri.013G125200 [exp]	27.27	0.8967

Compare expression of checked genes

Potri.007G096000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.