Potri.007G096300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10360 417 / 2e-149 RPS6B, EMB3010 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
AT4G31700 397 / 7e-142 RPS6A, RPS6 ribosomal protein S6 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G072700 455 / 1e-164 AT5G10360 416 / 2e-149 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.001G311000 452 / 2e-163 AT5G10360 421 / 3e-151 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.005G162600 446 / 3e-161 AT5G10360 419 / 1e-150 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.002G099500 441 / 3e-159 AT5G10360 413 / 6e-148 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007376 430 / 1e-154 AT5G10360 451 / 3e-163 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10031021 427 / 2e-153 AT5G10360 448 / 4e-162 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10027260 426 / 4e-153 AT5G10360 448 / 8e-162 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10035414 423 / 4e-151 AT5G10360 446 / 5e-160 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10020794 430 / 9e-146 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01092 Ribosomal_S6e Ribosomal protein S6e
Representative CDS sequence
>Potri.007G096300.1 pacid=42765201 polypeptide=Potri.007G096300.1.p locus=Potri.007G096300 ID=Potri.007G096300.1.v4.1 annot-version=v4.1
ATGAAGTTTAACATTGCAAATCCGACTACTGGGTGCCAGAAGAAGCTTGAAATCGATGATGATCAGAAACTCCGAGCGTTCTTTGACAAGAGGATCTCAC
AAGAAGTCAGTGGAGATGCACTGGGCGAGGAATTCAATGGTTATGTTTTTAAGATTATGGGAGGGTGTGACAAGCAGGGTTTCCCAATGAAGCAAGGAGT
TCTAACTCCAGGCCGTGTTCGTCTCTTGCTGCACAGAGGTACTCCTTGCTTCCGTGGATACGGCAGGAGAAATGGAGAGCGCAGGAGGAAGTCTGTTCGT
GGATGCATTGTTAGTCAAGATCTCTCTGTTTTGAACCTGGTCATCGTGAAGAAGGGAGAGAATGATCTTCCTGGCCTGACAGATGTTGAGAAGCCAAGGA
TGAGAGGTCCAAAGAGGGCATCAAAGATCAGGAAACTGTTTAACCTCTCTAAGGAGGATGATGTCCGGAAGTATGTCAACACTTACCGCAGAACATTTAC
AACCAAATCTGGTAAGAAGGTTAGCAAGGCTCCCAAAATTCAAAGGTTGGTTACTCCCTTGACTTTGCAAAGGAAGCGTGCAAGAATATCTGACAAGAAG
AAGAGAATCACAAAGGCCAAGGCTGAGGCAGCAGAGTATCAGAAGCTTCTTGCCACCAGGTTGAAGGAGCAGCGTGAACGCCGCAGTGAGAGCTTGGCAA
AGAAGAGATCTAGATTATCTGTTGCCTCAAAGCCCTCAGTTGTGGCTTAA
AA sequence
>Potri.007G096300.1 pacid=42765201 polypeptide=Potri.007G096300.1.p locus=Potri.007G096300 ID=Potri.007G096300.1.v4.1 annot-version=v4.1
MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVR
GCIVSQDLSVLNLVIVKKGENDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRARISDKK
KRITKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSVASKPSVVA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.007G096300 0 1
AT4G34670 Ribosomal protein S3Ae (.1) Potri.005G051200 3.46 0.9467
AT4G34555 Ribosomal protein S25 family p... Potri.008G020000 3.87 0.9496
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500 4.89 0.9571 ARP1.1
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G072700 5.65 0.9547
AT4G27090 Ribosomal protein L14 (.1) Potri.008G168600 8.94 0.9474
AT3G60770 Ribosomal protein S13/S15 (.1) Potri.014G068600 10.95 0.9444 RPS13.1
AT5G28060 Ribosomal protein S24e family ... Potri.008G152500 15.87 0.9447
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 16.24 0.9493 RPL17.2
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 17.88 0.9407
AT2G41840 Ribosomal protein S5 family pr... Potri.016G055000 19.44 0.9337 Pt-RPS2.3

Potri.007G096300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.