Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01720 366 / 4e-128 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G08790 333 / 5e-115 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G63790 317 / 2e-108 NAC ANAC102 NAC domain containing protein 102 (.1) AT1G77450 300 / 1e-102 NAC ANAC032 NAC domain containing protein 32 (.1) AT3G15500 228 / 3e-73 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 228 / 4e-73 NAC ANAC019 NAC domain containing protein 19 (.1) AT1G61110 225 / 5e-72 NAC ANAC025 NAC domain containing protein 25 (.1) AT4G27410 223 / 9e-72 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G04070 216 / 3e-68 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G69490 213 / 6e-68 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G069500 [exp] 574 / 0 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G081000 [exp] 388 / 2e-136 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G180200 [exp] 374 / 2e-131 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123300 [exp] 230 / 1e-73 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G123500 [exp] 229 / 3e-73 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.001G404100 [exp] 228 / 4e-73 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.001G404400 [exp] 228 / 7e-73 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 228 / 1e-72 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 227 / 2e-72 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025690 [exp] 385 / 6e-135 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10018142 [exp] 380 / 3e-133 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10042731 [exp] 360 / 2e-125 AT1G01720 414 / 7e-147 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020883 [exp] 356 / 1e-123 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 353 / 1e-122 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10029692 [exp] 235 / 2e-76 AT1G01720 268 / 9e-90 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10032657 [exp] 234 / 1e-74 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 232 / 5e-74 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10018469 [exp] 226 / 7e-72 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10011215 [exp] 226 / 8e-72 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.007G099400.2 pacid=42766641 polypeptide=Potri.007G099400.2.p locus=Potri.007G099400 ID=Potri.007G099400.2.v4.1 annot-version=v4.1 ATGAAAGGAAATAGATCAGCAGATCAGTTGGAGTTACCAGCTGGATTTAGATTTCATCCAACAGATGATGAGTTGGTGAATCATTACTTGCTTAAGAAAT GTGGAGGCCAATCAATTTCTGCTCCTATTATTGCTGAGATTGATCTTTATAAGTATGATCCTTGGCAGCTTCCAGAAATGGCACTATATGGTGAAAAGGA ATGGTACTTCTTTTCTCCAAGGGATAGAAAATATCCAAACGGTTCAAGGCCGAACCGGGCGGCTGGAACCGGGTATTGGAAAGCAACCGGAGCAGATAAA CCCATTGGTCGGCCCAAACCACTAGGCATAAAAAAAGCTCTTGTATTTTATGCTGGTAAAGCTCCTAAAGGAATCAAAACCAATTGGATCATGCATGAAT ATCGCCTTGCTAATGTTGACAGGACTGCCGGCAAGAAAAATAACCTCAGGCTTGATGATTGGGTATTATGTAGAATATACAACAAGAAAGGAAGCGTAGA GAAGCATTTTCCTGCTGAAAGAAAATCAATAGCAAAGTATCCAGAGATGGAAGAGCAGAAGCCCAACATCAGTGAAATGTCTGGCTACCATAATGGAATG TCACAAATTGCAGCACCGACAATGATGATGAGTAATAGCAATGACTTCTTATATATGGACACATCTGATTCAATTCCAAGGTTGAATACAGACTCAAGTA GTTCAGAGCACGTGCTGTCACCTGAGGTCACATGCGAGAAGGAGGTTCAGAGTCAGCCAAAATGGAATGATCAGCTAGATAATGCCTTCGATTTCAACTT CAATTACATTGATGATGGCTTCCAAGATTACCCTTTTGCTTCACAAGATCAGTTCCAATTGGACCAGCTCTCACCTTTGCAGGACATGTTCATGTATTTA CAGAAGCCATTTTGA
AA sequence Show only first row Show all	>Potri.007G099400.2 pacid=42766641 polypeptide=Potri.007G099400.2.p locus=Potri.007G099400 ID=Potri.007G099400.2.v4.1 annot-version=v4.1 MKGNRSADQLELPAGFRFHPTDDELVNHYLLKKCGGQSISAPIIAEIDLYKYDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADK PIGRPKPLGIKKALVFYAGKAPKGIKTNWIMHEYRLANVDRTAGKKNNLRLDDWVLCRIYNKKGSVEKHFPAERKSIAKYPEMEEQKPNISEMSGYHNGM SQIAAPTMMMSNSNDFLYMDTSDSIPRLNTDSSSSEHVLSPEVTCEKEVQSQPKWNDQLDNAFDFNFNYIDDGFQDYPFASQDQFQLDQLSPLQDMFMYL QKPF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Potri.007G099400 [exp]	0	1
AT3G47730		ABCA2, ATATH1	A. THALIANA ABC2 HOMOLOG 1, AT...		Potri.012G069800 [exp]	2.44	0.9024	PtrATH2,Pt-ATH1.2
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.013G106200 [exp]	3.87	0.9075
AT4G12731			unknown protein		Potri.001G226650 [exp]	6.24	0.9018
AT2G27580			A20/AN1-like zinc finger famil...		Potri.009G144100 [exp]	7.68	0.8349
AT4G12731			unknown protein		Potri.001G226750 [exp]	8.06	0.8934
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.001G332900 [exp]	9.38	0.8976
AT1G64160			Disease resistance-responsive ...		Potri.003G134600 [exp]	14.86	0.8668
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.013G153400 [exp]	15.65	0.8879
AT2G19460			Protein of unknown function (D...		Potri.006G147700 [exp]	16.24	0.8884
AT1G29290			unknown protein		Potri.004G061300 [exp]	21.72	0.8804

Compare expression of checked genes

Potri.007G099400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.