Potri.007G100900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27820 156 / 2e-50 Ribosomal L18p/L5e family protein (.1)
AT3G20230 51 / 1e-08 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G068300 84 / 2e-22 AT5G27820 68 / 2e-16 Ribosomal L18p/L5e family protein (.1)
Potri.013G108700 51 / 2e-08 AT3G20230 226 / 6e-76 Ribosomal L18p/L5e family protein (.1)
Potri.019G081000 50 / 3e-08 AT3G20230 249 / 4e-85 Ribosomal L18p/L5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031487 158 / 4e-51 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Lus10015194 158 / 4e-51 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Potri.007G100900.8 pacid=42765176 polypeptide=Potri.007G100900.8.p locus=Potri.007G100900 ID=Potri.007G100900.8.v4.1 annot-version=v4.1
ATGATTTATGACCTTTTTGTTCCTGTACCTATGATTTTATCGGCTTTTAATTTACAGATACAGATGGTTATTCCACCCCCAGTTAGGGCACCCAGAGTTA
CTCAGTTTCTGAAGCCCTATGTTCTGAAGATGCATTTCACAAACCAGTATGTGAATGCCCAAGTGACCCACTCACCAACAGCCACAGTAGCATCTGCTGC
AAGCTCACAGGAGAAGGCCCTGAGATCAACCATGGAAAATACCCGAGATGTGGCAGCTGCTGCCAAGATTGGGAAGATACTAGGAGAGCGCCTGCTGCTC
AAGGATATACCTGCTGTTACTGTTTTCCTGAACAGAAATCAGAAATACCATGGAAAGGTGAAAGCTGTGATTGATTCCTTAAGAGAAGTTGGTATCAAAA
TTATTTGA
AA sequence
>Potri.007G100900.8 pacid=42765176 polypeptide=Potri.007G100900.8.p locus=Potri.007G100900 ID=Potri.007G100900.8.v4.1 annot-version=v4.1
MIYDLFVPVPMILSAFNLQIQMVIPPPVRAPRVTQFLKPYVLKMHFTNQYVNAQVTHSPTATVASAASSQEKALRSTMENTRDVAAAAKIGKILGERLLL
KDIPAVTVFLNRNQKYHGKVKAVIDSLREVGIKII

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G27820 Ribosomal L18p/L5e family prot... Potri.007G100900 0 1
AT5G27430 Signal peptidase subunit (.1) Potri.018G058000 2.44 0.8133 SPP.2
AT2G46390 SDH8 succinate dehydrogenase 8, unk... Potri.014G095901 4.00 0.7698
AT3G06610 DNA-binding enhancer protein-r... Potri.010G146100 4.79 0.8287
AT4G03150 unknown protein Potri.014G135400 8.83 0.7332
AT3G09890 Ankyrin repeat family protein ... Potri.006G121500 13.03 0.7744
AT4G39880 Ribosomal protein L23/L15e fam... Potri.005G075500 16.43 0.7686
AT5G44170 S-adenosyl-L-methionine-depend... Potri.017G017000 16.85 0.6969
AT3G03773 HSP20-like chaperones superfam... Potri.019G038550 17.54 0.7100
AT4G17010 unknown protein Potri.012G038600 17.66 0.7162
AT5G64130 cAMP-regulated phosphoprotein ... Potri.004G111900 19.23 0.7174

Potri.007G100900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.