Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	KIWI.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09250 115 / 1e-34 KIWI ssDNA-binding transcriptional regulator (.1.2) AT5G09240 79 / 2e-20 ssDNA-binding transcriptional regulator (.1.2.3) AT4G10920 64 / 6e-14 KELP transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G067901 [exp] 66 / 8e-16 ND / Potri.002G171900 [exp] 65 / 3e-13 AT4G00980 373 / 7e-125 zinc knuckle (CCHC-type) family protein (.1) Potri.001G089400 [exp] 62 / 3e-13 AT4G10920 152 / 5e-48 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013733 [exp] 119 / 4e-36 AT5G09250 139 / 2e-44 ssDNA-binding transcriptional regulator (.1.2) Lus10039207 [exp] 105 / 1e-30 AT5G09250 125 / 1e-38 ssDNA-binding transcriptional regulator (.1.2) Lus10032410 [exp] 71 / 1e-16 AT4G10920 169 / 2e-54 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10030245 [exp] 60 / 3e-12 AT4G10920 136 / 3e-41 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10003998 [exp] 56 / 2e-10 AT4G00980 226 / 9e-68 zinc knuckle (CCHC-type) family protein (.1) Lus10023061 [exp] 55 / 3e-10 AT4G10920 132 / 7e-40 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0609 [poplar] [flax] sPC4_like PF02229 [poplar] [flax] PC4 Transcriptional Coactivator p15 (PC4)
Representative CDS sequence Show only first row Show all	>Potri.007G101100.1 pacid=42764882 polypeptide=Potri.007G101100.1.p locus=Potri.007G101100 ID=Potri.007G101100.1.v4.1 annot-version=v4.1 ATGTCCGGAAGAGGAGGAAAGAGAGCAGCAGCAGCAAGGGAGGAGGAAGGAAGTGGGGCTGATGACAACTATGCTCAACAACCACCGGCCAAGAAACCCA CCAAGGCTGACAACTCATCCTCTGATAACTCTGATGAAATTGTTGTTTGTGAGATAGGGAGGAATAGGAGAGTGACAGTCAGGAACTGGAGAGGAAAGAT TAATGTCGATATTCGTGAGTTTTATCCCAAAGATGGCAACCTTCTCCCTGGCAAAAAAGGTATTACCTTATCATTGGATCAGTGGAACATGCTCCGTGAT CATGTGGAAGAAATTGACAAGGCTCTTGGTCATTCTTAG
AA sequence Show only first row Show all	>Potri.007G101100.1 pacid=42764882 polypeptide=Potri.007G101100.1.p locus=Potri.007G101100 ID=Potri.007G101100.1.v4.1 annot-version=v4.1 MSGRGGKRAAAAREEEGSGADDNYAQQPPAKKPTKADNSSSDNSDEIVVCEIGRNRRVTVRNWRGKINVDIREFYPKDGNLLPGKKGITLSLDQWNMLRD HVEEIDKALGHS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Potri.007G101100 [exp]	0	1	KIWI.1
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.005G208100 [exp]	1.00	0.7979	OM14.1
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.014G158300 [exp]	2.44	0.7248	SMT3.2
AT1G03330			Small nuclear ribonucleoprotei...		Potri.003G014900 [exp]	12.96	0.7023
AT4G05420		DDB1A	damaged DNA binding protein 1A...		Potri.001G357900 [exp]	20.97	0.6294	Pt-DDB1.1
AT3G07910			unknown protein		Potri.009G071900 [exp]	21.00	0.6746
AT3G04680		CLPS3	CLP-similar protein 3 (.1.2)		Potri.017G077200 [exp]	23.23	0.6553
AT3G57062			unknown protein		Potri.006G041600 [exp]	27.62	0.6833
AT1G61700			RNA polymerases N / 8 kDa subu...		Potri.003G102900 [exp]	30.59	0.6341
AT4G33410		ATSPPL1	SIGNAL PEPTIDE PEPTIDASE-LIKE ...		Potri.015G145600 [exp]	31.08	0.6131
AT1G13950		EIF5A, ATELF5A-...	eukaryotic elongation factor 5...		Potri.018G107300 [exp]	36.94	0.6289	EIF.5

Compare expression of checked genes

Potri.007G101100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.