Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31305 67 / 1e-15 INH3 inhibitor-3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G067400 [exp] 82 / 2e-21 AT2G31305 66 / 4e-15 inhibitor-3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018105 [exp] 71 / 7e-17 AT2G31305 105 / 1e-30 inhibitor-3 (.1) Lus10022410 [exp] 71 / 1e-15 AT2G31305 104 / 1e-27 inhibitor-3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07491 [poplar] [flax] PPI_Ypi1 Protein phosphatase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.007G101900.3 pacid=42766308 polypeptide=Potri.007G101900.3.p locus=Potri.007G101900 ID=Potri.007G101900.3.v4.1 annot-version=v4.1 ATGAGCACCACCGCAACAACCGTCAGAAACGCCGCTGCAATGAGACCACCACCGCCTGCCTCTGCAACCACAACCATCCTAGAAAACCCCACCCAACAAC AACCACAAACCCTAACTTTGCGATTAAATCGACCGAAAAAGAAAGTTTCGTGGAAAGAAGGCACCGTAGACAACGAGTTTATGCAAAAAAAAAGTTCCAA AATTTGCTGTATATTTCACAAGGAGAAGCCCTTCGATGAGGATGACAGCGATGACGATGATTGCAATCACGATCATCATCATAACGATAATAAATCCGAC GGTGCTTGTTCTTCCTCTCAAAAAAACGGCGGTGATTGA
AA sequence Show only first row Show all	>Potri.007G101900.3 pacid=42766308 polypeptide=Potri.007G101900.3.p locus=Potri.007G101900 ID=Potri.007G101900.3.v4.1 annot-version=v4.1 MSTTATTVRNAAAMRPPPPASATTTILENPTQQQPQTLTLRLNRPKKKVSWKEGTVDNEFMQKKSSKICCIFHKEKPFDEDDSDDDDCNHDHHHNDNKSD GACSSSQKNGGD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31305		INH3	inhibitor-3 (.1)		Potri.007G101900 [exp]	0	1
AT1G58440		SQE1, XF1	SQUALENE EPOXIDASE 1, FAD/NAD(...		Potri.005G146700 [exp]	3.60	0.7570	Pt-XF1.2
AT4G10270			Wound-responsive family protei...		Potri.019G117100 [exp]	6.48	0.7473
AT5G40250			RING/U-box superfamily protein...		Potri.001G351466 [exp]	12.08	0.7567
AT4G10270			Wound-responsive family protei...		Potri.019G116932 [exp]	14.96	0.7039
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Potri.005G093900 [exp]	15.23	0.7183
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.016G012700 [exp]	18.02	0.6818
AT4G34131		UGT73B3	UDP-glucosyl transferase 73B3 ...		Potri.002G123700 [exp]	21.42	0.7168
AT4G40042			Microsomal signal peptidase 12...		Potri.010G059300 [exp]	21.42	0.6814
AT2G01470		ATSEC12, STL2P	SEC12P-like 2 protein (.1)		Potri.010G111800 [exp]	24.85	0.6303
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004000 [exp]	26.72	0.6866

Compare expression of checked genes

Potri.007G101900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.