Potri.007G102900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22560 97 / 6e-26 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT2G32020 81 / 1e-19 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT2G32030 79 / 7e-19 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G154700 109 / 7e-31 AT3G22560 177 / 3e-57 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.008G154800 100 / 4e-27 AT3G22560 225 / 3e-76 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.010G085600 82 / 4e-20 AT2G32030 223 / 6e-75 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021914 101 / 1e-27 AT3G22560 216 / 2e-72 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10041199 91 / 3e-24 AT3G22560 128 / 7e-39 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10039343 85 / 3e-21 AT3G22560 151 / 1e-46 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10006668 79 / 6e-19 AT2G32030 122 / 2e-35 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10007013 80 / 4e-18 AT5G64300 506 / 4e-174 RED FLUORESCENT IN DARKNESS 1, Arabidopsis thaliana riboflavin A1, ARABIDOPSIS THALIANA GTP CYCLOHYDROLASE II, GTP cyclohydrolase II (.1)
Lus10039344 72 / 2e-16 AT2G32030 236 / 4e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10010570 72 / 4e-16 AT2G32030 220 / 7e-74 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10032323 71 / 2e-15 AT2G32030 107 / 6e-29 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10010569 68 / 1e-14 AT3G22560 144 / 7e-44 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10039346 64 / 8e-14 AT2G32030 116 / 6e-34 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Representative CDS sequence
>Potri.007G102900.2 pacid=42765780 polypeptide=Potri.007G102900.2.p locus=Potri.007G102900 ID=Potri.007G102900.2.v4.1 annot-version=v4.1
ATGGCATCATCTTCGGATCAAACTAAAATGACCATCCCTTTGCACTTCAGGTCTATATGCTTAGATGATGATGATCGTTCTGCTGGATTTGTATCGATCC
AACCAAGGAGTGGTGATGGTAGATGCAGGGCGAATTTGGGATTTGCTTTGATTCCTGAGTATTGGAACCAAGGTGTTACAACTAGAGCTATTACTGAAGG
ATGGAAGTTGTTTCCTGAAGTGGCTAAGCTTGAAGCTATGGCTGATGTAGATAACAATGGCTGCCATAGGGTTATGGAGAAACTTGGGTTCCATAAGGAG
GGTGTCCTGAGGAAACACACGGTCATCAACGATAAGCTATTGGATTGTAGCAAGGACATGAACGGCTTCCCTGGGGAAAACAGATCAAGGATTGGATTGA
GGAAGCTCCTCTCTTCATTCAAATCATCACCACCTTAG
AA sequence
>Potri.007G102900.2 pacid=42765780 polypeptide=Potri.007G102900.2.p locus=Potri.007G102900 ID=Potri.007G102900.2.v4.1 annot-version=v4.1
MASSSDQTKMTIPLHFRSICLDDDDRSAGFVSIQPRSGDGRCRANLGFALIPEYWNQGVTTRAITEGWKLFPEVAKLEAMADVDNNGCHRVMEKLGFHKE
GVLRKHTVINDKLLDCSKDMNGFPGENRSRIGLRKLLSSFKSSPP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22560 Acyl-CoA N-acyltransferases (N... Potri.007G102900 0 1
AT4G27680 P-loop containing nucleoside t... Potri.012G025351 4.47 0.8712
AT4G30770 Putative membrane lipoprotein ... Potri.007G103000 4.89 0.8562
AT3G24520 HSF AT-HSFC1 heat shock transcription facto... Potri.018G079901 7.74 0.8150
Potri.002G166850 12.96 0.8101
Potri.019G131050 14.69 0.8230
AT1G44835 YbaK/aminoacyl-tRNA synthetase... Potri.002G085700 16.43 0.8309
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Potri.010G027201 17.29 0.8144
AT1G30220 ATINT2 ARABIDOPSIS THALIANA INOSITOL ... Potri.004G133340 20.78 0.7942
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Potri.019G050950 23.45 0.8173
AT3G42170 BED zinc finger ;hAT family di... Potri.011G125951 26.72 0.8282

Potri.007G102900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.