Potri.007G105000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64530 183 / 4e-59 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
AT1G61110 130 / 1e-36 NAC ANAC025 NAC domain containing protein 25 (.1)
AT1G69490 121 / 6e-34 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
AT1G52890 115 / 3e-31 NAC ANAC019 NAC domain containing protein 19 (.1)
AT1G01720 113 / 1e-30 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT3G15510 114 / 2e-30 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
AT3G15500 113 / 2e-30 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1)
AT5G63790 112 / 4e-30 NAC ANAC102 NAC domain containing protein 102 (.1)
AT1G77450 111 / 4e-30 NAC ANAC032 NAC domain containing protein 32 (.1)
AT3G04070 112 / 1e-29 NAC ANAC047 NAC domain containing protein 47 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G064100 297 / 5e-104 AT5G64530 199 / 3e-65 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Potri.001G206900 194 / 3e-63 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Potri.003G022800 192 / 1e-62 AT5G64530 231 / 5e-78 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Potri.001G404400 126 / 7e-35 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Potri.011G046700 124 / 2e-34 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
Potri.004G038000 124 / 4e-34 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1)
Potri.011G123500 123 / 9e-34 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Potri.008G089000 120 / 4e-33 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Potri.010G166200 117 / 5e-32 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000206 202 / 2e-66 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Lus10035648 202 / 2e-66 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Lus10035647 202 / 2e-66 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Lus10010747 196 / 6e-64 AT5G64530 259 / 4e-89 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1)
Lus10011215 135 / 1e-38 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1)
Lus10018469 135 / 2e-38 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1)
Lus10032657 131 / 1e-36 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Lus10043095 130 / 2e-36 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Lus10036773 127 / 7e-36 AT1G69490 318 / 1e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Lus10037156 125 / 3e-35 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Potri.007G105000.1 pacid=42766098 polypeptide=Potri.007G105000.1.p locus=Potri.007G105000 ID=Potri.007G105000.1.v4.1 annot-version=v4.1
ATGGGAGATCATGGCTGCAGTGGTAACCTTCCTCCGGGATTTGTTTTCAGCCCAACTGATGAAGAACTTGTCCTTCACTTTCTTCATCGCAAGGCCTCAC
TCTTACCTTGCAACCCTGACATCATTCCTGATCTTGGTCTCTATCCCCATGATCCCTGGCAACTTGAAGGCAAGGCTTTGTCAAGTGGAAACCAGTGGTT
CTACTTTAGTCAAGTGATGGAGAACCAAGTCACAGAAAATGGGTTTTGGAAATCATTAGATACTGAAGAACCTATATTTAGTAGTGCTGGTAAGAAGGTT
GGATTAAAGAAATACCTCGTGTATTGCATTGGTGCTGAAGGTGTAGAAACAAGCTGGATGATGCAGGAATATCATCTTTGCAACAGTAAATTGAGCGGCA
CATCTTACAAGAGAAAGAAAAAACTGGATTGCCATCAATGGATCCTGTGTCGAGTCTATGAAAGGGAGGGAAGCTGCATCCAAAACGTCGGCAATACCAC
TGATGATGATGACGGGACTGAACTTTCATGTCTAGATGAGATGTTCTTATCAATGGATGATGATCTTGATGATATAAGTTTTCCAAATTAG
AA sequence
>Potri.007G105000.1 pacid=42766098 polypeptide=Potri.007G105000.1.p locus=Potri.007G105000 ID=Potri.007G105000.1.v4.1 annot-version=v4.1
MGDHGCSGNLPPGFVFSPTDEELVLHFLHRKASLLPCNPDIIPDLGLYPHDPWQLEGKALSSGNQWFYFSQVMENQVTENGFWKSLDTEEPIFSSAGKKV
GLKKYLVYCIGAEGVETSWMMQEYHLCNSKLSGTSYKRKKKLDCHQWILCRVYEREGSCIQNVGNTTDDDDGTELSCLDEMFLSMDDDLDDISFPN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64530 NAC ANAC104, XND1 Arabidopsis NAC domain contain... Potri.007G105000 0 1
AT4G31970 CYP82C2, JAH1 "cytochrome P450, family 82, s... Potri.014G037900 3.16 0.8642 Pt-CYP82.16
AT1G71692 MADS XAL1, AGL12 XAANTAL1, AGAMOUS-like 12 (.1) Potri.013G102600 4.89 0.8673
AT5G60850 DOF OBP4, AtDof5. 4 OBF binding protein 4 (.1) Potri.011G054300 9.16 0.8708
Potri.016G013350 9.59 0.8304
AT2G16230 O-Glycosyl hydrolases family 1... Potri.002G261800 9.89 0.8392
Potri.011G165300 11.22 0.8548
Potri.002G023950 11.83 0.7594
AT5G17980 C2 calcium/lipid-binding plant... Potri.013G055500 12.64 0.8551
Potri.001G058500 12.84 0.8190
AT5G56520 unknown protein Potri.003G221500 13.34 0.7479

Potri.007G105000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.