Potri.007G106500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74880 181 / 5e-59 NdhO, NDH-O NADH dehydrogenase-like complex \), NAD(P)H:plastoquinone dehydrogenase complex subunit O (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002095 192 / 2e-63 AT1G74880 182 / 1e-59 NADH dehydrogenase-like complex \), NAD(P)H:plastoquinone dehydrogenase complex subunit O (.1)
Lus10000828 181 / 5e-59 AT1G74880 173 / 5e-56 NADH dehydrogenase-like complex \), NAD(P)H:plastoquinone dehydrogenase complex subunit O (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11910 NdhO Cyanobacterial and plant NDH-1 subunit O
Representative CDS sequence
>Potri.007G106500.1 pacid=42765417 polypeptide=Potri.007G106500.1.p locus=Potri.007G106500 ID=Potri.007G106500.1.v4.1 annot-version=v4.1
ATGGCTACTTTCTCTGCAACTCTACTAAAAAGCTCCTTTCCTTGCTTCTCTCTATTGCCACAGACTTTAAGAAGAAACCATCTTCATATTCCATCCATTA
GAGCTGTAAAATCCACTGAGCCAGAAAAAGAAAAGGCTACCAAAACTGAAGAACCCTCCACTAATGCACAACCTTCAACTTCAACCGCTGCTCCCAAGTC
CAAGAAACCTATTTATTCAATGAAGAAAGGACAGATTGTGAGAGTGGATAAAGAGAAGTACCTCAATAGCGTAAATTATCTATCTGTTGGGCATCCACCT
TACTACAAGGGCTTGGACTACATTTATGAAGACCGTGGTGAGGTCTTGGATTTACGGATATTTGAGACTGGAGAGTATGCTCTTGTTTCATGGGTTGGAG
TCCCCACTGCTCCGGCTTGGCTTCCAACAGACATGCTTATCAAGTCCGAGAAGCTGAATTACGAGAGATTGTGA
AA sequence
>Potri.007G106500.1 pacid=42765417 polypeptide=Potri.007G106500.1.p locus=Potri.007G106500 ID=Potri.007G106500.1.v4.1 annot-version=v4.1
MATFSATLLKSSFPCFSLLPQTLRRNHLHIPSIRAVKSTEPEKEKATKTEEPSTNAQPSTSTAAPKSKKPIYSMKKGQIVRVDKEKYLNSVNYLSVGHPP
YYKGLDYIYEDRGEVLDLRIFETGEYALVSWVGVPTAPAWLPTDMLIKSEKLNYERL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G74880 NdhO, NDH-O NADH dehydrogenase-like comple... Potri.007G106500 0 1
AT4G20360 AtRab8D, AtRABE... RAB GTPase homolog E1B (.1) Potri.003G121600 1.00 0.9925
AT4G17560 Ribosomal protein L19 family p... Potri.001G152200 3.00 0.9873
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Potri.010G215900 3.16 0.9876
AT5G62140 unknown protein Potri.012G134500 3.46 0.9864
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Potri.008G045800 5.47 0.9859
AT1G14345 NAD(P)-linked oxidoreductase s... Potri.010G093300 5.47 0.9846
AT5G20935 unknown protein Potri.009G155300 7.93 0.9832
AT4G20360 AtRab8D, AtRABE... RAB GTPase homolog E1B (.1) Potri.001G110200 8.36 0.9801
AT1G74970 TWN3, RPS9 ribosomal protein S9 (.1) Potri.014G039600 8.48 0.9820 RPS9.1
AT2G38780 unknown protein Potri.001G024200 11.00 0.9791

Potri.007G106500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.