Plant FIBer expression Database

Potri.007G106850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033482
[exp]
38 / 0.0006 AT2G13680 1556 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF14288 FKS1_dom1 1,3-beta-glucan synthase subunit FKS1, domain-1
Representative CDS sequence
>Potri.007G106850.1 pacid=42765961 polypeptide=Potri.007G106850.1.p locus=Potri.007G106850 ID=Potri.007G106850.1.v4.1 annot-version=v4.1
ATGGCCATCAGAAACTTCTGCAGAAGGATACTGTACATAGGTCTGTATCTGCTTATCTGGGGTGTAGGAGCTAATGTTTGCTTGATGCCGGAATGTCTGC
GCTATATTTTCACAATGTTTCTATTAGTTCACTCTCTAATTCACCGATTTTCATTATCCATTGCATGTTCAGTTAACTTAAGAGTCTCATTCGAATACCC
TCATTTAGTCATTTATGTCAGATGCCCAGTGAACTCCATGGTCTGCTGTCAGGAACTGCCACATTGCTTTTGCCGAAAACTTGAAACCTTACGGTGA
AA sequence
>Potri.007G106850.1 pacid=42765961 polypeptide=Potri.007G106850.1.p locus=Potri.007G106850 ID=Potri.007G106850.1.v4.1 annot-version=v4.1
MAIRNFCRRILYIGLYLLIWGVGANVCLMPECLRYIFTMFLLVHSLIHRFSLSIACSVNLRVSFEYPHLVIYVRCPVNSMVCCQELPHCFCRKLETLR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G106850
[exp]
0 1
AT1G14185 Glucose-methanol-choline (GMC)... Potri.008G087400
[exp]
11.83 0.8776
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Potri.001G303000
[exp]
12.96 0.9035
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Potri.001G303600
[exp]
13.56 0.8959
AT1G02780 EMB2386 embryo defective 2386, Ribosom... Potri.015G037100
[exp]
13.63 0.8742
Potri.002G020750
[exp]
20.78 0.9043
Potri.014G065000
[exp]
26.32 0.8732
AT2G25730 unknown protein Potri.018G035601
[exp]
30.59 0.9013
Potri.003G063150
[exp]
36.37 0.8669
AT1G12060 ATBAG5 BCL-2-associated athanogene 5 ... Potri.003G167500
[exp]
36.61 0.8957
AT5G40690 unknown protein Potri.001G336200
[exp]
41.23 0.8857

Potri.007G106850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.