Potri.007G107100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64650 258 / 9e-90 Ribosomal protein L17 family protein (.1)
AT5G09770 257 / 3e-89 Ribosomal protein L17 family protein (.1)
AT3G54210 111 / 4e-31 Ribosomal protein L17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G061700 273 / 1e-95 AT5G64650 257 / 4e-89 Ribosomal protein L17 family protein (.1)
Potri.006G113500 112 / 3e-31 AT3G54210 253 / 1e-85 Ribosomal protein L17 family protein (.1)
Potri.016G143100 111 / 6e-31 AT3G54210 258 / 7e-88 Ribosomal protein L17 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037314 254 / 6e-88 AT5G09770 274 / 6e-96 Ribosomal protein L17 family protein (.1)
Lus10035729 250 / 2e-86 AT5G09770 271 / 6e-95 Ribosomal protein L17 family protein (.1)
Lus10007002 112 / 2e-31 AT3G54210 244 / 2e-82 Ribosomal protein L17 family protein (.1)
Lus10000382 112 / 3e-31 AT3G54210 245 / 3e-82 Ribosomal protein L17 family protein (.1)
Lus10006999 112 / 1e-30 AT3G54210 248 / 1e-82 Ribosomal protein L17 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01196 Ribosomal_L17 Ribosomal protein L17
Representative CDS sequence
>Potri.007G107100.1 pacid=42765647 polypeptide=Potri.007G107100.1.p locus=Potri.007G107100 ID=Potri.007G107100.1.v4.1 annot-version=v4.1
ATGACTAAATTCAGAAAGCTAAATCGACCCACTGGTCACCGTATGTCCATGCTCAGAACTATGGTGTCCCAGTTGATTAAACACGAAAGGATTGAAACCA
CTGTTGCAAAGGCGAAAGAGATTCGACGTCTTGCTGATAATATGGTACAGCTTGGGAAAGAGGGTTCCCTTTGTGCCTCAAGGCGTGCCGCTGCATTTGT
TAGAGGGGATGATGTCATTCACAAGCTATTTTCTGAATTGGCTTACCGTTACAAGGACAGAGCAGGTGGTTACACAAGGATGCTTCGAACTCGCATAAGA
GTTGGTGATGCTGCACCAATGGCCTACATTGAGTTTATCGATAGAGAAAATGAGCTTAGACAGTCCAAACCGCCAACCCCTCAACCACCACAGAGAGCTC
CTATGGATCCCTGGACAAGATCACGGCTTACCAGGCAGTTTGCACCCCCTAAAGAAGAAAAGAGCTCTGATCCTGAGATATGA
AA sequence
>Potri.007G107100.1 pacid=42765647 polypeptide=Potri.007G107100.1.p locus=Potri.007G107100 ID=Potri.007G107100.1.v4.1 annot-version=v4.1
MTKFRKLNRPTGHRMSMLRTMVSQLIKHERIETTVAKAKEIRRLADNMVQLGKEGSLCASRRAAAFVRGDDVIHKLFSELAYRYKDRAGGYTRMLRTRIR
VGDAAPMAYIEFIDRENELRQSKPPTPQPPQRAPMDPWTRSRLTRQFAPPKEEKSSDPEI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64650 Ribosomal protein L17 family p... Potri.007G107100 0 1
AT4G37090 unknown protein Potri.007G034600 1.73 0.8910
AT3G18240 Ribosomal protein S24/S35, mit... Potri.015G044100 2.44 0.8851
AT1G49880 EMB3106, AtErv1... EMBRYO DEFECTIVE 3106, Erv1/Al... Potri.009G090200 5.47 0.8640
AT5G52820 WD-40 repeat family protein / ... Potri.009G058000 7.48 0.8359
AT3G18760 Translation elongation factor... Potri.018G113200 7.48 0.8362
AT5G63010 Transducin/WD40 repeat-like su... Potri.014G000900 9.21 0.8445
AT3G04020 unknown protein Potri.010G205900 9.79 0.8235
AT5G53070 Ribosomal protein L9/RNase H1 ... Potri.012G017300 11.48 0.8545
AT3G13160 Tetratricopeptide repeat (TPR)... Potri.011G032400 11.48 0.8291
AT1G07210 Ribosomal protein S18 (.1) Potri.006G170500 13.71 0.7893

Potri.007G107100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.