Potri.007G107600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
AT4G36040 81 / 6e-20 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
AT2G17880 77 / 2e-18 Chaperone DnaJ-domain superfamily protein (.1)
AT4G13830 73 / 5e-17 J20 DNAJ-like 20 (.1.2)
AT4G39960 62 / 4e-12 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT2G22360 62 / 7e-12 DNAJ heat shock family protein (.1)
AT2G35720 57 / 2e-10 OWL1 ORIENTATION UNDER VERY LOW FLUENCES OF LIGHT 1, DNAJ heat shock N-terminal domain-containing protein (.1)
AT3G17830 57 / 2e-10 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT4G37480 57 / 3e-10 Chaperone DnaJ-domain superfamily protein (.1)
AT1G80030 56 / 6e-10 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G469600 142 / 3e-44 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1)
Potri.011G166500 127 / 2e-38 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.006G001301 113 / 9e-33 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G240700 86 / 8e-22 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G113100 85 / 9e-22 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1)
Potri.004G172300 82 / 2e-20 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020800 81 / 5e-20 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020700 81 / 8e-20 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
Potri.009G131800 74 / 8e-18 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032957 119 / 4e-35 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1)
Lus10017263 82 / 4e-20 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10041906 77 / 2e-18 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10028453 76 / 7e-18 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1)
Lus10034484 74 / 1e-17 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10025060 74 / 1e-17 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10002355 70 / 2e-15 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
Lus10002356 67 / 2e-14 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
Lus10003150 66 / 7e-14 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2)
Lus10003149 65 / 3e-13 AT4G13830 141 / 5e-42 DNAJ-like 20 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Potri.007G107600.1 pacid=42765053 polypeptide=Potri.007G107600.1.p locus=Potri.007G107600 ID=Potri.007G107600.1.v4.1 annot-version=v4.1
ATGAATGCAACAACACTATTCACCGTCTCCCCACTCCTTTCATCGCTGGCGAACCGCCGGGGAGTCTCAATTAAAGCCGCCGTGTCAACATTAGCGGCCG
AGTCTTTCCGAGTTGACCCAGGGAGGAAGTCGCTGAGTCTGTACGAGATTCTTCAAGTTAAGAGAACGGCGTCGTTAACGGAGATTAAGGGTGCGTTTAG
GAGTCTAGCCAAGGTTTATCATCCTGATGTGAGCGGTAGTGATGGTGGAGAGCAATTGGACGGTCTGGATTTTGTTGAGATATGTAATGCCTATGAAACG
CTGTCGGATCCCGCTGCTCGTGCTATGTATGATTTGTCGTTGGGTTACAGTAGTAGCAGGAAGAGACCGGTTAGGTTTTCCGGTGGGTATTCTCTGAACC
GGCGGTGGGAAACTGATCAGTGCTGGTAA
AA sequence
>Potri.007G107600.1 pacid=42765053 polypeptide=Potri.007G107600.1.p locus=Potri.007G107600 ID=Potri.007G107600.1.v4.1 annot-version=v4.1
MNATTLFTVSPLLSSLANRRGVSIKAAVSTLAAESFRVDPGRKSLSLYEILQVKRTASLTEIKGAFRSLAKVYHPDVSGSDGGEQLDGLDFVEICNAYET
LSDPAARAMYDLSLGYSSSRKRPVRFSGGYSLNRRWETDQCW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13310 Chaperone DnaJ-domain superfam... Potri.007G107600 0 1
AT5G14700 NAD(P)-binding Rossmann-fold s... Potri.017G110500 8.36 0.8861
AT1G07650 Leucine-rich repeat transmembr... Potri.011G073366 9.00 0.8915
AT1G29730 Leucine-rich repeat transmembr... Potri.011G072591 19.59 0.8864
AT3G24450 Heavy metal transport/detoxifi... Potri.018G076400 22.44 0.8793
AT1G29730 Leucine-rich repeat transmembr... Potri.011G072991 23.23 0.8864
AT1G29740 Leucine-rich repeat transmembr... Potri.011G073166 29.39 0.8762
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Potri.019G118900 35.62 0.8670
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Potri.011G152100 42.77 0.8643
AT1G29450 SAUR-like auxin-responsive pro... Potri.004G181500 47.25 0.8599
AT5G49330 MYB PFG3, ATMYB111 PRODUCTION OF FLAVONOL GLYCOSI... Potri.001G086700 53.23 0.8025

Potri.007G107600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.