Potri.007G110100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18690 119 / 2e-33 MKS1 MAP kinase substrate 1 (.1)
AT1G68450 56 / 9e-10 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT1G21326 54 / 1e-08 VQ motif-containing protein (.1)
AT1G21320 49 / 8e-07 nucleotide binding;nucleic acid binding (.1.2)
AT3G18360 43 / 8e-05 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G057800 285 / 8e-99 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Potri.005G189300 101 / 3e-26 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
Potri.002G070600 97 / 1e-24 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1)
Potri.012G055900 45 / 5e-06 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.015G046600 45 / 6e-06 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1)
Potri.010G123700 45 / 6e-06 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.006G199300 39 / 0.0004 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029768 63 / 4e-12 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10042794 52 / 1e-08 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1)
Lus10028604 45 / 1e-05 ND /
Lus10009033 45 / 1e-05 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10012286 37 / 0.0009 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.007G110100.2 pacid=42766569 polypeptide=Potri.007G110100.2.p locus=Potri.007G110100 ID=Potri.007G110100.2.v4.1 annot-version=v4.1
ATGGACCCTTACCGCTATCCCACCACCGGCAAACCACCACCACCACCACCTAAAAAACAACTCCAAATCCAAGGCCCTAGACCTTCAGCACTAAAACTAA
ACCAAGACTCTCACAAAATCAAGAAACCACCTCCCCCTCCTCCAAAGCAACCTGTCGTCATCTATGCAGTCTCTCCAAAGACCATCCACACGGAGGAATC
CAACTTCATGGCCGTCGTCCAACGGTTAACAGGTCTCTCCTCCGGTGACTTCTTCCACGATGGGTCTGTTTCTCCAGCTGCAAGACTTGCTGCCACTGAG
AAAGCAAGTCCAAGAGAATTAACAAGACCAAGTAACACTCAAGATAGTAGTGATGACGATCTCATGGAGATGCTTAAAGAAGTGGGTGCTGGTCAGATTC
CAGGGATCTTGTCACCGGCACCGGCGATGTTACCGCCAGTACCAACTGGGTTTTTCTCTCCAGCGTCAACGGATGCAAATTCGCAGTCTTTCTTGAATGA
TAATTTTAATATGAGTCCATTCTTCATGGCCAGTCCTTCAGGTTTATTTCCAGGTCCTAGTATAGTTTCTCCTTTACATTCTCCTGATATTTTTAGCAGC
CTGTTCATGGATTTCTAG
AA sequence
>Potri.007G110100.2 pacid=42766569 polypeptide=Potri.007G110100.2.p locus=Potri.007G110100 ID=Potri.007G110100.2.v4.1 annot-version=v4.1
MDPYRYPTTGKPPPPPPKKQLQIQGPRPSALKLNQDSHKIKKPPPPPPKQPVVIYAVSPKTIHTEESNFMAVVQRLTGLSSGDFFHDGSVSPAARLAATE
KASPRELTRPSNTQDSSDDDLMEMLKEVGAGQIPGILSPAPAMLPPVPTGFFSPASTDANSQSFLNDNFNMSPFFMASPSGLFPGPSIVSPLHSPDIFSS
LFMDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G18690 MKS1 MAP kinase substrate 1 (.1) Potri.007G110100 0 1
AT1G80300 ATNTT1 nucleotide transporter 1 (.1) Potri.001G175200 1.73 0.9184 AATP1.1,PtrAATP1
Potri.017G111050 2.23 0.9165
AT1G64950 CYP89A5 "cytochrome P450, family 89, s... Potri.007G088154 2.44 0.9345
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.007G088018 3.16 0.9270
AT1G76250 unknown protein Potri.002G011400 3.74 0.9140
AT3G02910 AIG2-like (avirulence induced ... Potri.019G041100 4.00 0.9124
AT3G03980 NAD(P)-binding Rossmann-fold s... Potri.013G059100 4.24 0.9158
AT1G35620 ATPDI8, ATPDIL5... ARABIDOPSIS THALIANA PROTEIN D... Potri.019G082400 6.70 0.9084
AT2G47820 unknown protein Potri.008G210200 7.07 0.9036
AT4G33890 unknown protein Potri.009G090500 8.42 0.8540

Potri.007G110100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.