Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10030 52 / 3e-09 Trihelix aspartate/glutamate/uridylate kinase family protein (.1.2) AT3G18680 0 / 1 Amino acid kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G233500 [exp] 48 / 4e-08 AT3G10030 434 / 3e-148 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.008G027000 [exp] 47 / 9e-08 AT3G10030 457 / 2e-157 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.006G117300 [exp] 44 / 1e-06 AT3G10030 591 / 0.0 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.005G057700 [exp] 0 / 1 AT3G18680 467 / 1e-166 Amino acid kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008988 [exp] 49 / 4e-08 AT3G10030 450 / 3e-154 aspartate/glutamate/uridylate kinase family protein (.1.2) Lus10033492 [exp] 0 / 1 AT3G18680 438 / 4e-155 Amino acid kinase family protein (.1) Lus10020884 [exp] 0 / 1 AT3G18680 452 / 8e-161 Amino acid kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G110301.1 pacid=42766794 polypeptide=Potri.007G110301.1.p locus=Potri.007G110301 ID=Potri.007G110301.1.v4.1 annot-version=v4.1 ATGCTGTGGGTAGCAATTGTAGTTGGCGGTGGGAATATCTTCCGTGGATCTTCATGGGCAGGAAGCACAGGTCTTGACTGGTCATCTGCTGATTATATGG GGATGCTGGCAACTGTAATGAATGCTATTTTCTTCAAGCAACAATGGAGAGTATTGGCATCTCAACAAGGGTTCAGACTGCATTTCGCATGTCAGAGGTT GCAGAACCATATATCCGTAGATGGGACATAA
AA sequence Show only first row Show all	>Potri.007G110301.1 pacid=42766794 polypeptide=Potri.007G110301.1.p locus=Potri.007G110301 ID=Potri.007G110301.1.v4.1 annot-version=v4.1 MLWVAIVVGGGNIFRGSSWAGSTGLDWSSADYMGMLATVMNAIFFKQQWRVLASQQGFRLHFACQRLQNHISVDGT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18680			Amino acid kinase family prote...		Potri.007G110301 [exp]	0	1
					Potri.005G130500 [exp]	1.41	0.8944
AT1G55860		UPL1	ubiquitin-protein ligase 1 (.1...		Potri.005G066950 [exp]	3.46	0.8503
AT5G49840			ATP-dependent Clp protease (.1...		Potri.004G229400 [exp]	4.00	0.8959
					Potri.010G015666 [exp]	4.58	0.8496
AT3G07180			GPI transamidase component PIG...		Potri.002G245000 [exp]	9.21	0.8513
AT4G37020			unknown protein		Potri.007G043200 [exp]	11.13	0.8521
AT5G05550	Trihelix		sequence-specific DNA binding ...		Potri.010G186200 [exp]	12.84	0.8563
AT1G44835			YbaK/aminoacyl-tRNA synthetase...		Potri.002G085700 [exp]	14.83	0.8476
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.018G011650 [exp]	15.90	0.8468
					Potri.010G007250 [exp]	20.78	0.8363

Compare expression of checked genes

Potri.007G110301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.