Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18715 53 / 8e-11 IDL4 inflorescence deficient in abscission (IDA)-like 4 (.1) AT5G64667 53 / 9e-11 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1) AT5G09805 44 / 3e-07 IDL3 inflorescence deficient in abscission (IDA)-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G057400 [exp] 110 / 1e-33 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G189900 [exp] 53 / 5e-11 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 49 / 2e-09 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.010G131500 [exp] 40 / 1e-05 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.008G114600 [exp] 38 / 7e-05 AT1G68765 46 / 5e-08 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005811 [exp] 71 / 1e-17 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1) Lus10033523 [exp] 68 / 1e-16 AT3G18715 51 / 8e-10 inflorescence deficient in abscission (IDA)-like 4 (.1) Lus10020848 [exp] 63 / 6e-15 AT3G18715 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 4 (.1) Lus10034260 [exp] 39 / 5e-05 AT1G68765 44 / 6e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10034385 [exp] 39 / 5e-05 AT1G68765 44 / 5e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G110700.1 pacid=42766614 polypeptide=Potri.007G110700.1.p locus=Potri.007G110700 ID=Potri.007G110700.1.v4.1 annot-version=v4.1 ATGGTTGCATGTAGAAGACCTCTAACTCTACTTCTTTGTCTCTTCTTCTTGTTCTTCATTTTCTTTGTTGGTTACTCTCTTGGTTCAAGGTCCACCCATG TATTTAAATTCAAGCCCAAAACTCAGTACAAAGGTCATTTCTTCAATTTGTTGCCAAGACATTTACCTATACCAACTTCTGGCCCTTCAAGGAGACACAA CGACATTGGCTTACAGAATTGGAAATCACCATGA
AA sequence Show only first row Show all	>Potri.007G110700.1 pacid=42766614 polypeptide=Potri.007G110700.1.p locus=Potri.007G110700 ID=Potri.007G110700.1.v4.1 annot-version=v4.1 MVACRRPLTLLLCLFFLFFIFFVGYSLGSRSTHVFKFKPKTQYKGHFFNLLPRHLPIPTSGPSRRHNDIGLQNWKSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64667		IDL2	inflorescence deficient in abs...		Potri.007G110700 [exp]	0	1
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Potri.014G027100 [exp]	1.41	0.8892	Pt-HSFB4.2
AT4G23720			Protein of unknown function (D...		Potri.001G096000 [exp]	1.41	0.8817
AT1G47655	DOF		Dof-type zinc finger DNA-bindi...		Potri.002G129600 [exp]	3.00	0.8730
AT1G18670		IBS1	IMPAIRED IN BABA-INDUCED STERI...		Potri.015G061400 [exp]	5.65	0.8463
AT5G28150			Plant protein of unknown funct...		Potri.005G050900 [exp]	6.00	0.8597
AT4G21450			PapD-like superfamily protein ...		Potri.019G116400 [exp]	7.41	0.8374
AT4G38660			Pathogenesis-related thaumatin...		Potri.004G173200 [exp]	8.66	0.8570
AT5G17600			RING/U-box superfamily protein...		Potri.003G093100 [exp]	9.00	0.8442
AT4G09890			Protein of unknown function (D...		Potri.005G195800 [exp]	10.09	0.8176
AT5G15080			Protein kinase superfamily pro...		Potri.006G066100 [exp]	10.95	0.8296

Compare expression of checked genes

Potri.007G110700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.