Potri.007G111000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05430 147 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G30933 111 / 1e-30 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT5G56590 113 / 1e-29 O-Glycosyl hydrolases family 17 protein (.1)
AT4G29360 109 / 4e-28 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G66870 101 / 4e-28 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66250 105 / 6e-27 O-Glycosyl hydrolases family 17 protein (.1)
AT5G55180 105 / 8e-27 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G29380 102 / 2e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G09460 102 / 2e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G26830 101 / 2e-25 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G012000 231 / 1e-78 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.019G007800 230 / 4e-78 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.018G068600 135 / 1e-37 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.011G078500 110 / 8e-30 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.013G003500 112 / 3e-29 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.005G003500 112 / 4e-29 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.002G059600 105 / 3e-28 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.001G353400 105 / 7e-28 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.004G153800 102 / 1e-25 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023276 187 / 6e-61 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10038529 178 / 5e-57 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10012937 122 / 3e-33 AT5G56590 617 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10034987 121 / 7e-33 AT5G56590 562 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10018306 112 / 2e-29 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10031443 112 / 2e-29 AT2G30933 143 / 2e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10001516 111 / 2e-29 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10015151 111 / 8e-29 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10040600 110 / 8e-29 AT5G55180 630 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10007342 107 / 9e-29 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.007G111000.1 pacid=42765787 polypeptide=Potri.007G111000.1.p locus=Potri.007G111000 ID=Potri.007G111000.1.v4.1 annot-version=v4.1
ATGAGAAACAAAGTACTAGTTTTGCCATGTCTCTTGTTGCTGCAATGTTATCTAGTCCTGACAATGGAGACTGCAACGCAAGAGAAAGCAGAATCTGCGA
TCCCAGTGACAACATTGTCACCTCCAGAAGGCAACATAACTTTTCTTGGTGGCACAACATGGTGTGTTGCCCTGTCAGGTGTCTCTCAAATTGATTTGCA
GAATGCATTAGACTGGACCTGTGGTCTAGGCATGGCAGATTGCAGTCCAATCCAAGAGGGTGGAGCGTGTTTTGATCCTGACACGCTAGTTTCTCATGCC
TCCTATGCTTTCAACAACTATTACCAACAAAATGAGAATTCTGAAATTGCTTGCAATTTCGGAGGAACTGCCGTTTTAACTAGAAAGGATCCTAGTCATG
GAAAATGTAGCTATGCTGCACCTGGATCTGCTGCTAAGTCGCCAGCACCTTCTTTGCTCAAGGGGCGCAGAGCAAACTTTATATGGTTGAAGTTTGCTGG
GATTTTTCTGCTTTTGTACTTGAGAAGATGA
AA sequence
>Potri.007G111000.1 pacid=42765787 polypeptide=Potri.007G111000.1.p locus=Potri.007G111000 ID=Potri.007G111000.1.v4.1 annot-version=v4.1
MRNKVLVLPCLLLLQCYLVLTMETATQEKAESAIPVTTLSPPEGNITFLGGTTWCVALSGVSQIDLQNALDWTCGLGMADCSPIQEGGACFDPDTLVSHA
SYAFNNYYQQNENSEIACNFGGTAVLTRKDPSHGKCSYAAPGSAAKSPAPSLLKGRRANFIWLKFAGIFLLLYLRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G05430 Carbohydrate-binding X8 domain... Potri.007G111000 0 1
AT4G02380 SAG21, ATLEA5 Arabidopsis thaliana late embr... Potri.003G072000 1.41 0.9715
AT3G26350 unknown protein Potri.010G049000 1.41 0.9764
AT1G11925 Stigma-specific Stig1 family p... Potri.004G030900 2.00 0.9586
AT3G62100 AUX_IAA IAA30 indole-3-acetic acid inducible... Potri.002G186400 3.74 0.8761 IAA4.1
AT5G14510 ARM repeat superfamily protein... Potri.001G344200 4.47 0.9472
AT5G38895 RING/U-box superfamily protein... Potri.010G140300 4.89 0.9092
AT1G06475 unknown protein Potri.002G058400 5.74 0.8917
AT3G47180 RING/U-box superfamily protein... Potri.002G080900 5.91 0.9126
AT3G61250 MYB LMI2, ATMYB17 LATE MERISTEM IDENTITY2, myb d... Potri.012G140700 6.70 0.8757
Potri.003G217500 7.74 0.9462

Potri.007G111000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.