Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16580 48 / 3e-08 SAUR-like auxin-responsive protein family (.1) AT4G34760 47 / 5e-08 SAUR-like auxin-responsive protein family (.1) AT4G34780 47 / 1e-07 SAUR-like auxin-responsive protein family (.1) AT2G18010 46 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT2G21210 43 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT4G38840 43 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT4G36110 41 / 1e-05 SAUR-like auxin-responsive protein family (.1) AT4G38860 41 / 2e-05 SAUR-like auxin-responsive protein family (.1) AT2G21220 41 / 2e-05 SAUR-like auxin-responsive protein family (.1) AT4G34770 40 / 2e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G052501 [exp] 163 / 1e-53 AT4G34780 47 / 6e-08 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 47 / 1e-07 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 43 / 2e-06 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.004G165800 [exp] 43 / 3e-06 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 42 / 6e-06 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 42 / 6e-06 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 42 / 8e-06 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 42 / 1e-05 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 41 / 1e-05 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042378 [exp] 46 / 3e-07 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 45 / 3e-07 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 44 / 1e-06 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 44 / 1e-06 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 44 / 1e-06 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 44 / 2e-06 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 43 / 2e-06 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 43 / 2e-06 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 42 / 6e-06 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 42 / 6e-06 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.007G112000.1 pacid=42766028 polypeptide=Potri.007G112000.1.p locus=Potri.007G112000 ID=Potri.007G112000.1.v4.1 annot-version=v4.1 ATGAAAATGATTCAAAAAAGGCTTCGATCCCTTGCAGCAAGGTTAAACTTGAAGAAGCAGAAGAAGGGTTACGAGAAGCAAGTGCCTATACCAAGCAAAC ACTTTCCAGTGTATGTTGGTGATCAAGAACTTGAAGGAAATCTAAAACGTTATGATGTTCCAGTTGCATGCACATCTTCCATAATCTTCCAAGCTTTGCT TCGTCAATTCGATGATATCCTAGCAGTAGACGAAGGGCCAATCACATTATCTTGCTCAAAACAGATGTTTGAGTCTGTCCTCAAACTTTCTCTTGACGGG TTAAGAATAGAAGAGGTGAAGAAGTTGACAGATTTCCACCACTAA
AA sequence Show only first row Show all	>Potri.007G112000.1 pacid=42766028 polypeptide=Potri.007G112000.1.p locus=Potri.007G112000 ID=Potri.007G112000.1.v4.1 annot-version=v4.1 MKMIQKRLRSLAARLNLKKQKKGYEKQVPIPSKHFPVYVGDQELEGNLKRYDVPVACTSSIIFQALLRQFDDILAVDEGPITLSCSKQMFESVLKLSLDG LRIEEVKKLTDFHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16580			SAUR-like auxin-responsive pro...		Potri.007G112000 [exp]	0	1
					Potri.001G168901 [exp]	32.78	0.7412
AT3G50180			Plant protein of unknown funct...		Potri.016G040000 [exp]	41.83	0.7207
AT3G18670			Ankyrin repeat family protein ...		Potri.011G019750 [exp]	46.47	0.7287
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Potri.006G086100 [exp]	72.93	0.7126	EXPA3.1,PtEXPA16
AT4G34760			SAUR-like auxin-responsive pro...		Potri.004G164400 [exp]	75.97	0.6910	SAUR29
AT1G67750			Pectate lyase family protein (...		Potri.008G182200 [exp]	105.98	0.6652
AT1G60420			DC1 domain-containing protein ...		Potri.008G175600 [exp]	138.44	0.6766
AT4G38430		ATROPGEF1, ROPG...	rho guanyl-nucleotide exchange...		Potri.002G014100 [exp]	173.12	0.6654
AT3G13275			unknown protein		Potri.005G061200 [exp]	193.95	0.6442
AT4G33670			NAD(P)-linked oxidoreductase s...		Potri.009G081300 [exp]	274.95	0.6259

Compare expression of checked genes

Potri.007G112000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.