Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64350 201 / 8e-69 FKP12, ATFKBP12, FKBP12 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) AT3G55520 72 / 1e-16 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 70 / 3e-15 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 67 / 6e-14 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT4G25340 63 / 1e-12 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT5G45680 60 / 4e-12 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT5G05420 54 / 3e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48580 52 / 3e-09 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G10060 50 / 3e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 49 / 5e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149400 [exp] 82 / 3e-19 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.006G033400 [exp] 76 / 4e-17 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 75 / 8e-17 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.010G201600 [exp] 67 / 9e-15 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.008G057900 [exp] 65 / 3e-14 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 63 / 1e-12 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.012G129200 [exp] 63 / 1e-12 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.001G075500 [exp] 58 / 3e-11 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.016G096600 [exp] 54 / 1e-09 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016586 [exp] 195 / 7e-65 AT5G64350 189 / 2e-62 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) Lus10003760 [exp] 192 / 9e-65 AT5G64350 185 / 2e-62 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) Lus10003171 [exp] 81 / 8e-19 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 76 / 3e-17 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10004714 [exp] 74 / 3e-17 AT3G55520 265 / 3e-91 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040280 [exp] 74 / 3e-17 AT3G55520 263 / 1e-90 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038216 [exp] 70 / 4e-15 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 70 / 5e-15 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10006949 [exp] 61 / 4e-12 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10031700 [exp] 61 / 4e-12 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.007G113100.1 pacid=42766176 polypeptide=Potri.007G113100.1.p locus=Potri.007G113100 ID=Potri.007G113100.1.v4.1 annot-version=v4.1 ATGGGAGTGGAGAAACAAGTTGTCAGACCCGGAACTGGTCCCAAACCAACTGCTGGTCAAAACGTGACCGTTCATTGCACTGGTTTTGGGAAAAATCGTG ATCTCTCACAGAAGTTTTGGAGCACCAAGGATCCAGGGCAAAAGCCTTTCGCGTTCAAAATTGGCCAAGGATCTGTCATAAAGGGATGGGATGAAGGTGT CATGGGAATGCAAGTGGGAGAAGTTGCTCGCCTGCGGTGTTCTCCTGACTATGCTTATGGAGCTGGTGGATTTCCAGCTTGGGGAATACAACCAAACTCG GTCCTGGATTTTGAGATTGAAGTCATAAGTTTGGAGTGA
AA sequence Show only first row Show all	>Potri.007G113100.1 pacid=42766176 polypeptide=Potri.007G113100.1.p locus=Potri.007G113100 ID=Potri.007G113100.1.v4.1 annot-version=v4.1 MGVEKQVVRPGTGPKPTAGQNVTVHCTGFGKNRDLSQKFWSTKDPGQKPFAFKIGQGSVIKGWDEGVMGMQVGEVARLRCSPDYAYGAGGFPAWGIQPNS VLDFEIEVISLE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Potri.007G113100 [exp]	0	1
AT1G02140		MAGO, HAP1, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.014G049700 [exp]	1.73	0.8714
AT4G30010			unknown protein		Potri.006G075600 [exp]	1.73	0.9007
AT5G20920		EIF2 BETA, EMB1...	embryo defective 1401, eukaryo...		Potri.013G158400 [exp]	2.00	0.8848	Pt-EIF2.3
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Potri.001G277900 [exp]	4.00	0.8703	Pt-SAD1.2
AT1G52740		HTA9	histone H2A protein 9 (.1)		Potri.006G249400 [exp]	5.47	0.8644	HTA906
AT4G14615			unknown protein		Potri.010G079100 [exp]	11.13	0.8085
AT3G05100			S-adenosyl-L-methionine-depend...		Potri.013G034000 [exp]	12.24	0.8349
AT4G22310			Uncharacterised protein family...		Potri.011G023100 [exp]	12.72	0.8295
AT5G47890			NADH-ubiquinone oxidoreductase...		Potri.003G159100 [exp]	12.96	0.8170
AT1G04290			Thioesterase superfamily prote...		Potri.004G134066 [exp]	13.74	0.8258

Compare expression of checked genes

Potri.007G113100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.