Plant FIBer expression Database

Potri.007G113150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58122 56 / 3e-13 CPuORF45 conserved peptide upstream open reading frame 45 (.1)
AT5G03190 38 / 4e-06 CPuORF47 conserved peptide upstream open reading frame 47 (.1.2.3)
AT3G53402 38 / 5e-06 CPuORF46 conserved peptide upstream open reading frame 46 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G104450
[exp]
63 / 4e-16 AT1G58122 63 / 4e-16 conserved peptide upstream open reading frame 45 (.1)
Potri.017G047750
[exp]
57 / 1e-13 ND /
Potri.016G088850
[exp]
36 / 4e-05 AT5G03190 47 / 2e-09 conserved peptide upstream open reading frame 47 (.1.2.3)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G113150.1 pacid=42765436 polypeptide=Potri.007G113150.1.p locus=Potri.007G113150 ID=Potri.007G113150.1.v4.1 annot-version=v4.1
ATGGAAATTGAGAGAATTAAGGTGCTGTTGCTCCTTTGGTGTAGAATCAAAAGTACTCGTGTGGCCCTCGTGGGTGGAAACCACACAGCTTCCAGGTTTT
GCACTCGCTAA
AA sequence
>Potri.007G113150.1 pacid=42765436 polypeptide=Potri.007G113150.1.p locus=Potri.007G113150 ID=Potri.007G113150.1.v4.1 annot-version=v4.1
MEIERIKVLLLLWCRIKSTRVALVGGNHTASRFCTR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.007G113150
[exp]
0 1
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.001G216800
[exp]
1.00 0.9878
AT5G14280 GeBP DNA-binding storekeeper protei... Potri.010G056000
[exp]
1.41 0.9756
Potri.005G187000
[exp]
2.44 0.9532
AT2G16880 Pentatricopeptide repeat (PPR)... Potri.008G044050
[exp]
2.82 0.9521
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.006G090033
[exp]
3.46 0.9468
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.005G158000
[exp]
3.87 0.8571
Potri.010G080633
[exp]
3.87 0.9502
AT5G36930 Disease resistance protein (TI... Potri.010G231250
[exp]
4.47 0.8942
AT5G52552 CPuORF14 conserved peptide upstream ope... Potri.017G143300
[exp]
4.89 0.9144
AT5G07900 Mitochondrial transcription te... Potri.004G012300
[exp]
5.09 0.8837

Potri.007G113150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.