Potri.007G114001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24840 43 / 3e-06 MADS DIA, AGL61 DIANA, AGAMOUS-like 61 (.1)
AT5G60440 43 / 4e-06 MADS AGL62 AGAMOUS-like 62 (.1)
AT1G01530 36 / 0.0007 MADS AGL28 AGAMOUS-like 28 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G113800 91 / 2e-24 AT5G60440 191 / 4e-60 AGAMOUS-like 62 (.1)
Potri.017G047300 91 / 4e-24 AT5G60440 185 / 2e-57 AGAMOUS-like 62 (.1)
Potri.009G084200 76 / 1e-18 AT5G60440 211 / 2e-68 AGAMOUS-like 62 (.1)
Potri.009G084100 55 / 1e-10 AT5G60440 163 / 2e-49 AGAMOUS-like 62 (.1)
Potri.008G041500 40 / 3e-05 AT5G60440 147 / 4e-43 AGAMOUS-like 62 (.1)
Potri.004G010200 38 / 0.0001 AT5G60440 100 / 5e-26 AGAMOUS-like 62 (.1)
Potri.009G046100 37 / 0.0004 AT5G60440 115 / 6e-32 AGAMOUS-like 62 (.1)
Potri.004G130900 36 / 0.0006 AT3G04100 140 / 5e-42 AGAMOUS-like 57 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012449 50 / 9e-09 AT5G60440 157 / 4e-47 AGAMOUS-like 62 (.1)
Lus10020511 49 / 2e-08 AT5G60440 162 / 9e-49 AGAMOUS-like 62 (.1)
PFAM info
Representative CDS sequence
>Potri.007G114001.1 pacid=42765587 polypeptide=Potri.007G114001.1.p locus=Potri.007G114001 ID=Potri.007G114001.1.v4.1 annot-version=v4.1
ATGCAGCTATCTCAGAAAAGAGGTCAAGAGTTGGACAGAAAGGGGAAAGCCAGTCAGAGTCAGAACTGGTGGGAGAATCCTATCGAGGAACTTGACATGG
CACAGCTTGAACAATTGAAGGCATCTTTACAGGGTCTCAAGCATGATGTAGCCAGGCAAGCCGAGCAGATTCTGATTCAAAATCTGAATCCTCCTCAGCC
TATATATGGACACACAAAACACCAGTACTAA
AA sequence
>Potri.007G114001.1 pacid=42765587 polypeptide=Potri.007G114001.1.p locus=Potri.007G114001 ID=Potri.007G114001.1.v4.1 annot-version=v4.1
MQLSQKRGQELDRKGKASQSQNWWENPIEELDMAQLEQLKASLQGLKHDVARQAEQILIQNLNPPQPIYGHTKHQY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.007G114001 0 1
AT5G28780 PIF1 helicase (.1) Potri.006G157501 14.07 1.0000
AT1G02790 PGA4 polygalacturonase 4 (.1) Potri.010G011200 15.23 1.0000
AT3G02310 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K... Potri.004G115500 19.44 1.0000
AT2G24370 Protein kinase protein with ad... Potri.018G002400 27.91 1.0000
Potri.006G055550 40.39 0.9414
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.009G084200 43.68 0.9368
Potri.001G380550 44.39 0.9251
Potri.010G080666 47.56 0.9904
AT4G10613 RNA-directed DNA polymerase (r... Potri.006G139150 48.37 1.0000
Potri.001G169351 48.95 1.0000

Potri.007G114001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.