Potri.007G114200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G113900 53 / 1e-09 ND /
Potri.017G047200 43 / 5e-06 ND /
Potri.017G046800 42 / 2e-05 ND /
Potri.017G045900 41 / 2e-05 ND /
Potri.017G045600 41 / 2e-05 ND /
Potri.017G045800 41 / 2e-05 ND /
Potri.017G047000 41 / 4e-05 ND /
Potri.017G046700 40 / 6e-05 ND /
Potri.007G114100 40 / 6e-05 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G114200.1 pacid=42764899 polypeptide=Potri.007G114200.1.p locus=Potri.007G114200 ID=Potri.007G114200.1.v4.1 annot-version=v4.1
ATGGCAAGTTTCAACTGTTTCATCTTAGCTCTCCTCATTGCTTTCTCTTTTCCAGGCGGCGAGGCAGCTCGTCATCTTCTGCAATTGCCCCCTTTACCTT
CCGTGCCGAATTTGCCTAAACCAACGTTGCCACCAATGCCTTCTATGCCAACACTGCCACAGCCCCCCTTGCCAACTTTGCCCACCACACAACCTTCACT
GCCTAAACCCACTCTGCCTCCACTTCCCAGCCTGCCAACAATGCCCAGTCTCCCCAAGGTGACCTTGCCTCCACTTCCAAGCATGCCCTCAAATATTCCC
ACTATCCCTATCCCAACTACAATTCCCTCTATTCCATTCCTCTCCCCACCACCAGCTGGAAACTAG
AA sequence
>Potri.007G114200.1 pacid=42764899 polypeptide=Potri.007G114200.1.p locus=Potri.007G114200 ID=Potri.007G114200.1.v4.1 annot-version=v4.1
MASFNCFILALLIAFSFPGGEAARHLLQLPPLPSVPNLPKPTLPPMPSMPTLPQPPLPTLPTTQPSLPKPTLPPLPSLPTMPSLPKVTLPPLPSMPSNIP
TIPIPTTIPSIPFLSPPPAGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G114200 0 1
Potri.007G113900 1.00 0.9993
Potri.017G046800 2.00 0.9963
AT5G09520 PELPK2 Pro-Glu-Leu|Ile|Val-Pro-Lys 2,... Potri.007G114525 2.44 0.9895
Potri.019G082733 3.16 0.9914
Potri.019G082600 3.46 0.9936
AT5G06800 GARP myb-like HTH transcriptional r... Potri.001G228500 6.63 0.9621
AT3G11430 ATGPAT5, GPAT5 glycerol-3-phosphate acyltrans... Potri.010G201200 9.00 0.9668
Potri.017G047100 9.89 0.9705
AT4G16380 Heavy metal transport/detoxifi... Potri.006G018901 10.09 0.9538
Potri.017G047200 12.64 0.9625

Potri.007G114200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.