Potri.007G118800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22104 506 / 7e-176 Phototropic-responsive NPH3 family protein (.1)
AT3G19850 283 / 1e-88 Phototropic-responsive NPH3 family protein (.1)
AT1G50280 244 / 5e-74 Phototropic-responsive NPH3 family protein (.1)
AT5G48800 223 / 3e-65 Phototropic-responsive NPH3 family protein (.1)
AT3G08570 222 / 1e-64 Phototropic-responsive NPH3 family protein (.1)
AT3G44820 220 / 7e-64 Phototropic-responsive NPH3 family protein (.1)
AT5G66560 219 / 1e-63 Phototropic-responsive NPH3 family protein (.1)
AT3G50840 216 / 7e-63 Phototropic-responsive NPH3 family protein (.1)
AT1G30440 205 / 3e-58 Phototropic-responsive NPH3 family protein (.1)
AT5G03250 197 / 8e-56 Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G041600 957 / 0 AT3G22104 488 / 4e-169 Phototropic-responsive NPH3 family protein (.1)
Potri.004G030600 491 / 2e-169 AT3G22104 313 / 1e-100 Phototropic-responsive NPH3 family protein (.1)
Potri.011G032100 457 / 3e-156 AT3G22104 309 / 4e-99 Phototropic-responsive NPH3 family protein (.1)
Potri.008G085500 331 / 1e-106 AT3G19850 449 / 2e-152 Phototropic-responsive NPH3 family protein (.1)
Potri.010G170900 329 / 1e-105 AT3G19850 426 / 2e-143 Phototropic-responsive NPH3 family protein (.1)
Potri.009G150500 229 / 2e-67 AT3G44820 826 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.007G033900 224 / 4e-65 AT5G66560 789 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.002G242300 222 / 7e-65 AT5G48800 899 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.004G189800 222 / 8e-65 AT3G44820 835 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039710 617 / 0 AT3G22104 433 / 9e-148 Phototropic-responsive NPH3 family protein (.1)
Lus10018499 600 / 0 AT3G22104 420 / 2e-142 Phototropic-responsive NPH3 family protein (.1)
Lus10034200 249 / 2e-75 AT3G19850 390 / 1e-129 Phototropic-responsive NPH3 family protein (.1)
Lus10012901 241 / 2e-71 AT3G19850 415 / 3e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10030554 234 / 5e-69 AT3G19850 414 / 5e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10037432 224 / 3e-65 AT5G66560 747 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10025928 222 / 9e-65 AT5G48800 925 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10041276 223 / 1e-64 AT5G66560 750 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10019522 221 / 3e-64 AT3G44820 781 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10023274 207 / 4e-59 AT1G30440 910 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Potri.007G118800.1 pacid=42766461 polypeptide=Potri.007G118800.1.p locus=Potri.007G118800 ID=Potri.007G118800.1.v4.1 annot-version=v4.1
ATGGCAGTTTGCTGTGATCTTGAAGTAGATGTCAATGGTGAAGAGACGTTCATGGTGGATAAGAAGGTCATTGCTTCATATTGTGGCAGATTAAGAAAAT
TATTTGGTAAATCAACAGGTAGTGCAAGAAATTTGAAAGTGATATTCAATGACTTTCCTGGTGGGGCTGGAAATTTTGAACTCCTGTCAAGATTCTGCTA
CAATAACGGTAGGATTGACATAACTCCTTCAAATATTTCCTTCCTACATTCTGCTGCACAGTTCATGGAGATGAACAATTCTGTATCTGGAACTCATAAC
TTATTGGAAGAGACAGAGAAATCACTTAAAGGGATGAATTACTGGGCATGGTCTGAGCTATTAATCACTATAAAGCAGTGCCAAGATTTACTTCCGTTTC
CAAATTCTTCTGGTATTCTTGAAAAATGTGTGGATTCTCTTATTGGAAGGATGGCTACTTCTAGTGAGCCTAGTCCATGTCCATCTACTTCTTCTCCTGA
TAGCTCTGGAGTCCGGTTTTCATGTGACACTAGAAGCACTGAGAGTTTGAAGAATAGCTTCTCTCGAGCAACCTGGTGGTTTGAGGATCTTTTGGTTTTG
AGCACTAATTTGGTTGGAATGGTGATCAAATCCATGGTCTTGCGGAAGTTTGATCATGCTATCATTAGTAGGTTTCTCTTTTATTACCAGAAATCGAAGT
GCTATACTGGCACGTCTGATGAGAAGCGTAATGTAGTAGAAACTGTCATAGATATACTTTATATTCTTGATTGGAACTCTGTTTCATTCAAGAGTTTATT
TGGAATTCTTCGAGTTGCTTTGAATTTGAACATAAGCAAATGTAGCAGGACCAAGTTGGAGAGTATGATAGGTTCTCAGATGGATCAAGCAACTCTAGAT
AATCTGCTTATTCCTTCTCCATATGGGATGAATTACTTGTATAACGTGAAGCTTGTTCTAAGGTTCTTGAAAGCATTTCTGCACGGAGGAATCAGTCAAA
CGTCTCCAACACAATTGAGAAAAGTTGCTAGTTTGATGGACTTGTATATAGCAGAAGTAGCCCCAGATCCTTGTCTAAAGCCTTCTAAGTTCTTGGCCCT
AACCATGTCTCTGCCAGATTCTGCCAGAGATTCATATGACAGAATCTACCGTGCCACAGACATGTATCTACAGGTGCATACTGGATTATCAGAAGAAGAA
AAGATGAAGATATGCTGTGCATTGAATTATGAGAAGCTCTCAGCTGAAGCTTGCATCCACCTTTCTCAGAACAAAAGGTTTCCATCAAAAAGTGCAGTCC
AAGCTCTCATGTCTCAGCAAGTCAAGCTCAAAAGCTTACTCAAAGCCACCGACAAAATGAAATGCTATATTGATTCACCTTCTGGTGTTAGTGAGATTGG
AAGGAAGGGAAAGAAAAATGAAGCCAGTGAACAAATTGTGCTCTATGCTGGTAAACTTGATCCTCCAACTAACAATGAGAAGCTTAGAGCCCATTTGCAA
GGAATGCAATGGAGGGTGACGGAATTGGAGAAAATTTGCTTGAAAATGCAAACACAGATGACAAAAATCATAAAGTCAAGAGTATCAAGCCATAGCACTC
CCAGATCCTTACCCAAGCTTTGTTCATGA
AA sequence
>Potri.007G118800.1 pacid=42766461 polypeptide=Potri.007G118800.1.p locus=Potri.007G118800 ID=Potri.007G118800.1.v4.1 annot-version=v4.1
MAVCCDLEVDVNGEETFMVDKKVIASYCGRLRKLFGKSTGSARNLKVIFNDFPGGAGNFELLSRFCYNNGRIDITPSNISFLHSAAQFMEMNNSVSGTHN
LLEETEKSLKGMNYWAWSELLITIKQCQDLLPFPNSSGILEKCVDSLIGRMATSSEPSPCPSTSSPDSSGVRFSCDTRSTESLKNSFSRATWWFEDLLVL
STNLVGMVIKSMVLRKFDHAIISRFLFYYQKSKCYTGTSDEKRNVVETVIDILYILDWNSVSFKSLFGILRVALNLNISKCSRTKLESMIGSQMDQATLD
NLLIPSPYGMNYLYNVKLVLRFLKAFLHGGISQTSPTQLRKVASLMDLYIAEVAPDPCLKPSKFLALTMSLPDSARDSYDRIYRATDMYLQVHTGLSEEE
KMKICCALNYEKLSAEACIHLSQNKRFPSKSAVQALMSQQVKLKSLLKATDKMKCYIDSPSGVSEIGRKGKKNEASEQIVLYAGKLDPPTNNEKLRAHLQ
GMQWRVTELEKICLKMQTQMTKIIKSRVSSHSTPRSLPKLCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22104 Phototropic-responsive NPH3 fa... Potri.007G118800 0 1
AT5G50350 unknown protein Potri.015G091500 1.00 0.9063
AT4G13310 CYP71A20 "cytochrome P450, family 71, s... Potri.003G192300 2.82 0.8724
AT5G39660 DOF CDF2, AtDof5. 2 cycling DOF factor 2 (.1.2) Potri.017G084600 3.46 0.8434
AT1G58210 EMB1674 EMBRYO DEFECTIVE 1674, kinase ... Potri.002G106400 4.00 0.8341
AT1G55850 ATCSLE1 cellulose synthase like E1 (.1... Potri.001G369100 6.00 0.8546 ATCSLE1.1
AT1G31690 Copper amine oxidase family pr... Potri.008G151900 7.34 0.8488 DAO.3
AT3G60340 alpha/beta-Hydrolases superfam... Potri.002G137200 8.00 0.8597
AT1G54330 NAC ANAC020 NAC domain containing protein ... Potri.008G081500 8.24 0.8323
AT2G33590 NAD(P)-binding Rossmann-fold s... Potri.002G004100 8.30 0.8672
AT5G21482 ATCKX5, CKX7 ARABIDOPSIS THALIANA CYTOKININ... Potri.006G221000 12.00 0.8026

Potri.007G118800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.