Potri.007G119100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G041400 112 / 6e-33 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G119100.1 pacid=42766061 polypeptide=Potri.007G119100.1.p locus=Potri.007G119100 ID=Potri.007G119100.1.v4.1 annot-version=v4.1
ATGAAGTTCTTAGCACGCTTGGGTTCATGTTACTTCTCAACCACGGCAATAGCAGCAGCTCCTGAGGTGGAGGATGTGGATGTGGATGTGGTGGAGCAGG
CAGCAGCAGCTACCACCGTGATTAATGGTGATGTTACACTGCTAGCGCCGGGAAGTGGAAGGAGAAGCAAATCAAGAGGACGTGGATCATGGCGTCCGGC
CCTTTCGGCTATATCGGAAGACGGGAGGATCTCATTTAGACGGAGAAAACCAGCTGAGACTACTGAGAAGAAAGCAGTCAAAGCACTGGCTAGCAAAGTG
ATGAAAAAACCAGAGGCTCAAAATCTTACTGCGCAGATGTCATTTTCCGGTTTCTCTCCGACACCGTTTATGTTTTGA
AA sequence
>Potri.007G119100.1 pacid=42766061 polypeptide=Potri.007G119100.1.p locus=Potri.007G119100 ID=Potri.007G119100.1.v4.1 annot-version=v4.1
MKFLARLGSCYFSTTAIAAAPEVEDVDVDVVEQAAAATTVINGDVTLLAPGSGRRSKSRGRGSWRPALSAISEDGRISFRRRKPAETTEKKAVKALASKV
MKKPEAQNLTAQMSFSGFSPTPFMF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G119100 0 1
AT1G69320 CLE10 CLAVATA3/ESR-RELATED 10 (.1) Potri.008G093500 2.82 0.9512
AT1G79770 Protein of unknown function (D... Potri.001G188700 4.24 0.9468
AT4G35160 O-methyltransferase family pro... Potri.013G122400 4.47 0.9429
AT4G27290 S-locus lectin protein kinase ... Potri.011G125100 6.48 0.9337
AT3G24140 bHLH bHLH097, FMA FAMA, basic helix-loop-helix (... Potri.017G054500 8.94 0.9291
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Potri.013G075600 9.79 0.9320
AT4G17970 ATALMT12, ALMT1... "aluminum-activated, malate tr... Potri.001G144300 10.09 0.9344
AT3G47570 Leucine-rich repeat protein ki... Potri.017G152500 10.24 0.9416
AT3G47570 Leucine-rich repeat protein ki... Potri.017G151400 17.86 0.9207
AT2G28260 ATCNGC15 cyclic nucleotide-gated channe... Potri.009G010700 18.16 0.9178 CNGC15.1

Potri.007G119100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.