Potri.007G120300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 194 / 9e-62 Receptor-like protein kinase-related family protein (.1)
AT3G58310 162 / 2e-49 Domain of unknown function (DUF26) (.1)
AT3G21990 132 / 9e-38 Domain of unknown function (DUF26) (.1)
AT4G20670 129 / 2e-36 Domain of unknown function (DUF26) (.1)
AT2G31620 127 / 2e-35 Receptor-like protein kinase-related family protein (.1)
AT4G05200 117 / 7e-30 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT4G20640 114 / 3e-29 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20620 114 / 3e-29 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20610 114 / 3e-29 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20570 114 / 3e-29 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120600 421 / 2e-151 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1)
Potri.007G120601 319 / 6e-112 AT3G22060 199 / 9e-65 Receptor-like protein kinase-related family protein (.1)
Potri.017G040049 310 / 3e-107 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1)
Potri.017G040300 304 / 7e-105 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Potri.007G120401 246 / 3e-82 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120500 246 / 3e-82 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120400 245 / 8e-82 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120700 243 / 4e-81 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1)
Potri.007G120501 242 / 1e-80 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027145 173 / 2e-53 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1)
Lus10039699 133 / 1e-37 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10027144 122 / 1e-34 ND 121 / 1e-34
Lus10007632 120 / 5e-31 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10038227 115 / 7e-31 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
Lus10018377 118 / 3e-30 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10018382 111 / 7e-28 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10025875 107 / 9e-28 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1)
Lus10018380 108 / 3e-27 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10026629 109 / 4e-27 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Potri.007G120300.1 pacid=42765529 polypeptide=Potri.007G120300.1.p locus=Potri.007G120300 ID=Potri.007G120300.1.v4.1 annot-version=v4.1
ATGTCTTCCTCCAGATTCACCTCCTCTCTCTACCTTCTAACTCTCTCTATACTTCTCCAAAATGTTCTTGGAGTTGACCCTCTATATAGTAGCTGTTCAG
GCAACGAGAAATCAACTGCTAACTATGGCTCTTATAAAACAAGCTTGGACGTTCTAATGAGTTCTTTCTACCAACTTGCACCAGCTAAGGAAGGCTTTGC
CCTTGGTTCTTTAGGTCAGAAAAACCTAGACCGACCCTATGGGCTCGTTCTTTGCAGAGGAGATGTCTCATCCTCGGACTGCAGTGCCTGTGTTGCTGAT
GCAACCAGGGAGATCCGCAAGCGATGCCCATACGGTAAAAGTGGATTCATCGCTTACGATAACTGTCTACTGAAGTATTCAAACAAGGACTTCTTTGGCC
AGATTGACAGCCAAAACAAGATCTACTTGTATAACGTGCGAAATGTGAGCAATCCAGTGGTATTTAATCAGAAGACAAAGGACTTGTTGAGCCAACTGGC
AAACAAGGCTTATATCGCAAGGAAAATGTATGCCACTGGAGAGTTGGGCCTTGGGGGATCGAAGAAACTTTACGGAATGGCTCAATGCACAAGGGATCTC
TCTAGTGCTAATTGTAAGAAGTGTCTTGATGGTGCTATAAGTGAGCTTCAAGGTTTTGCTGGTGGAAAAGAAGGGGGTAGGGTTACTGGTGGGAGTTGTA
CGGTTAGATATGAGATTTATCCATTTGTTAAAGCTTAA
AA sequence
>Potri.007G120300.1 pacid=42765529 polypeptide=Potri.007G120300.1.p locus=Potri.007G120300 ID=Potri.007G120300.1.v4.1 annot-version=v4.1
MSSSRFTSSLYLLTLSILLQNVLGVDPLYSSCSGNEKSTANYGSYKTSLDVLMSSFYQLAPAKEGFALGSLGQKNLDRPYGLVLCRGDVSSSDCSACVAD
ATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQIDSQNKIYLYNVRNVSNPVVFNQKTKDLLSQLANKAYIARKMYATGELGLGGSKKLYGMAQCTRDL
SSANCKKCLDGAISELQGFAGGKEGGRVTGGSCTVRYEIYPFVKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22060 Receptor-like protein kinase-r... Potri.007G120300 0 1
AT4G21895 DNA binding (.1) Potri.011G001901 1.00 0.9697
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.013G131200 1.41 0.9686
AT2G34930 disease resistance family prot... Potri.001G262800 1.73 0.9684
AT3G22060 Receptor-like protein kinase-r... Potri.007G120601 2.82 0.9648
AT4G26200 ACS7, ATACS7 1-amino-cyclopropane-1-carboxy... Potri.018G067000 4.00 0.9536 Pt-ACS3.2
AT4G20820 FAD-binding Berberine family p... Potri.011G162968 5.74 0.9500
AT5G53110 RING/U-box superfamily protein... Potri.015G017800 6.92 0.9466
AT5G51160 Ankyrin repeat family protein ... Potri.012G113800 7.07 0.9607
AT3G22060 Receptor-like protein kinase-r... Potri.007G120600 7.14 0.9353
AT4G00910 Aluminium activated malate tra... Potri.002G174600 7.48 0.9580

Potri.007G120300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.