Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22060 270 / 1e-91 Receptor-like protein kinase-related family protein (.1) AT3G58310 234 / 3e-77 Domain of unknown function (DUF26) (.1) AT4G20670 173 / 3e-53 Domain of unknown function (DUF26) (.1) AT3G21990 172 / 3e-53 Domain of unknown function (DUF26) (.1) AT2G31620 165 / 2e-50 Receptor-like protein kinase-related family protein (.1) AT3G21960 156 / 1e-46 Receptor-like protein kinase-related family protein (.1.2) AT4G20640 160 / 3e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1) AT4G20620 160 / 3e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1) AT4G20610 160 / 3e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1) AT4G20570 160 / 3e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120401 [exp] 464 / 1e-168 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1) Potri.007G120500 [exp] 430 / 5e-155 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1) Potri.007G120700 [exp] 426 / 2e-153 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1) Potri.007G120501 [exp] 409 / 2e-146 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1) Potri.017G040450 [exp] 400 / 4e-143 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1) Potri.017G039966 [exp] 395 / 2e-141 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1) Potri.017G040049 [exp] 277 / 2e-94 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1) Potri.007G120300 [exp] 268 / 4e-91 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1) Potri.017G040300 [exp] 267 / 1e-90 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027145 [exp] 259 / 4e-87 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1) Lus10018382 [exp] 179 / 3e-52 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10039699 [exp] 169 / 9e-52 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1) Lus10007632 [exp] 177 / 2e-51 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10038227 [exp] 161 / 1e-48 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1) Lus10018380 [exp] 163 / 9e-48 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018377 [exp] 159 / 1e-44 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10025875 [exp] 148 / 9e-44 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1) Lus10007634 [exp] 143 / 3e-39 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10018379 [exp] 139 / 2e-37 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.007G120400.1 pacid=42765447 polypeptide=Potri.007G120400.1.p locus=Potri.007G120400 ID=Potri.007G120400.1.v4.1 annot-version=v4.1 ATGTCTTTCTCCAACTTCGCCTCCTTTCTATGTCTCTTAGCCTTTTCTCTCCTTGTCCACACTGGTTTTGGAGCTGACCCACTTTTCCATTTCTGTTCAA CTCCTGAGAACTTCACTGCCAATGGCCCATATGAATCCAACCTAAACAAGCTTACTAGTTTCCTCTACTATCAAGCCCCTCGTACAGGTTTTGGTATGGG TTCAAAAGGCCAGAAACCGGTCCAAGCATATGGGCTCGCTCTCTGTAGAGGTGACGCCTCAACCTCAGATTGCAAGACCTGTGTTGTTGAGGCAGGCAGT GAGATTCGAAAGCGCTGTCCATACAATGAAGCGGCCATCATTTGGTATGATAACTGTCTTTTGAAGTACTCAAACAAAGGATTCTTTGGCCAAATTGATA ATGGAAACAAGTTCTATATGTGGAACGTGAATGCTGTAAGTGAGCCAGTTCCATTCAATGAAAAGACCAAAGAGCTTTTGACCCAGCTTGCCAATAAAGC TAAAGCAACCCCCAAGTTGTACGCAACAGGAGGGATGGAGCTAGGAGAATCAACCAAGCTATATGGCTTGGTCCAGTGCACTCGGGATCTTTCTAGTGCT GTCTGTAAGAAATGCCTCGATGGTATAATCGGTGAACTTCCAAGCTGCTGTGACGGGAAAGAAGGTGGCAGAGTTGTCAGTGGGAGTTGCAATTTCAGAT ATGAAATATACCCTTTTGTCAATGCTTAA
AA sequence Show only first row Show all	>Potri.007G120400.1 pacid=42765447 polypeptide=Potri.007G120400.1.p locus=Potri.007G120400 ID=Potri.007G120400.1.v4.1 annot-version=v4.1 MSFSNFASFLCLLAFSLLVHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQAPRTGFGMGSKGQKPVQAYGLALCRGDASTSDCKTCVVEAGS EIRKRCPYNEAAIIWYDNCLLKYSNKGFFGQIDNGNKFYMWNVNAVSEPVPFNEKTKELLTQLANKAKATPKLYATGGMELGESTKLYGLVQCTRDLSSA VCKKCLDGIIGELPSCCDGKEGGRVVSGSCNFRYEIYPFVNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120400 [exp]	0	1
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120401 [exp]	1.00	0.8665
AT1G01900		SBTI1.1, ATSBT1...	subtilase family protein (.1)		Potri.014G074600 [exp]	3.16	0.7054
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120501 [exp]	5.09	0.7827
AT1G47740			PPPDE putative thiol peptidase...		Potri.002G134200 [exp]	8.12	0.6530
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120700 [exp]	8.48	0.7039
AT3G22060			Receptor-like protein kinase-r...		Potri.017G040450 [exp]	9.48	0.6564
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092932 [exp]	14.38	0.7220
AT1G47056		VFB1	VIER F-box proteine 1 (.1)		Potri.014G023500 [exp]	16.97	0.6194
AT5G25820			Exostosin family protein (.1)		Potri.006G239000 [exp]	23.51	0.6882
					Potri.005G167800 [exp]	26.38	0.6477

Compare expression of checked genes

Potri.007G120400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.